data_1E1B # _entry.id 1E1B # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1E1B PDBE EBI-4890 WWPDB D_1292000005 # loop_ _pdbx_database_PDB_obs_spr.id _pdbx_database_PDB_obs_spr.date _pdbx_database_PDB_obs_spr.pdb_id _pdbx_database_PDB_obs_spr.replace_pdb_id _pdbx_database_PDB_obs_spr.details OBSLTE 2000-10-03 1E5U 1E1B ? SPRSDE 2000-05-02 1E1B 1INM ? # _pdbx_database_status.status_code OBS _pdbx_database_status.entry_id 1E1B _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.recvd_initial_deposition_date 2000-04-28 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Prasannan, S.' 1 'Matthews, S.J.' 2 'Batchelor, M.' 3 'Daniell, S.' 4 'Reece, S.' 5 'Frankel, G.' 6 'Dougan, G.' 7 'Connerton, I.' 8 'Bloomberg, G.' 9 # _citation.id primary _citation.title 'Structural Basis for Recognition of the Translocated Intimin Receptor (Tir) by Intimin from Enteropathogenic E. Coli' _citation.journal_abbrev 'Embo J.' _citation.journal_volume 19 _citation.page_first 2452 _citation.page_last ? _citation.year 2000 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Batchelor, M.' 1 primary 'Prasannan, S.' 2 primary 'Daniell, S.' 3 primary 'Reece, S.' 4 primary 'Connerton, I.' 5 primary 'Bloomberg, G.' 6 primary 'Dougan, G.' 7 primary 'Frankel, G.' 8 primary 'Matthews, S.J.' 9 # _cell.entry_id 1E1B _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1E1B _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description INTIMIN _entity.formula_weight 20074.328 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'C-TERMINAL 190 RESIDUE-FRAGMENT' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name INT190 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TLTIDDGNIEIVGTGVKGKLPTVWLQYGQVNLKASGGNGKYTWRSANPAIASVDASSGQVTLKEKGTTTISVISSDNQTA TYTIATPNSLIVPNMSKRVTYNDAVNTCKNFGGKLPSSQNELENVFKAWGAANKYEYYKSSQTIISWVQQTAQDAKSGVA STYDLVKQNPLNNIKASESNAYATCVK ; _entity_poly.pdbx_seq_one_letter_code_can ;TLTIDDGNIEIVGTGVKGKLPTVWLQYGQVNLKASGGNGKYTWRSANPAIASVDASSGQVTLKEKGTTTISVISSDNQTA TYTIATPNSLIVPNMSKRVTYNDAVNTCKNFGGKLPSSQNELENVFKAWGAANKYEYYKSSQTIISWVQQTAQDAKSGVA STYDLVKQNPLNNIKASESNAYATCVK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 LEU n 1 3 THR n 1 4 ILE n 1 5 ASP n 1 6 ASP n 1 7 GLY n 1 8 ASN n 1 9 ILE n 1 10 GLU n 1 11 ILE n 1 12 VAL n 1 13 GLY n 1 14 THR n 1 15 GLY n 1 16 VAL n 1 17 LYS n 1 18 GLY n 1 19 LYS n 1 20 LEU n 1 21 PRO n 1 22 THR n 1 23 VAL n 1 24 TRP n 1 25 LEU n 1 26 GLN n 1 27 TYR n 1 28 GLY n 1 29 GLN n 1 30 VAL n 1 31 ASN n 1 32 LEU n 1 33 LYS n 1 34 ALA n 1 35 SER n 1 36 GLY n 1 37 GLY n 1 38 ASN n 1 39 GLY n 1 40 LYS n 1 41 TYR n 1 42 THR n 1 43 TRP n 1 44 ARG n 1 45 SER n 1 46 ALA n 1 47 ASN n 1 48 PRO n 1 49 ALA n 1 50 ILE n 1 51 ALA n 1 52 SER n 1 53 VAL n 1 54 ASP n 1 55 ALA n 1 56 SER n 1 57 SER n 1 58 GLY n 1 59 GLN n 1 60 VAL n 1 61 THR n 1 62 LEU n 1 63 LYS n 1 64 GLU n 1 65 LYS n 1 66 GLY n 1 67 THR n 1 68 THR n 1 69 THR n 1 70 ILE n 1 71 SER n 1 72 VAL n 1 73 ILE n 1 74 SER n 1 75 SER n 1 76 ASP n 1 77 ASN n 1 78 GLN n 1 79 THR n 1 80 ALA n 1 81 THR n 1 82 TYR n 1 83 THR n 1 84 ILE n 1 85 ALA n 1 86 THR n 1 87 PRO n 1 88 ASN n 1 89 SER n 1 90 LEU n 1 91 ILE n 1 92 VAL n 1 93 PRO n 1 94 ASN n 1 95 MET n 1 96 SER n 1 97 LYS n 1 98 ARG n 1 99 VAL n 1 100 THR n 1 101 TYR n 1 102 ASN n 1 103 ASP n 1 104 ALA n 1 105 VAL n 1 106 ASN n 1 107 THR n 1 108 CYS n 1 109 LYS n 1 110 ASN n 1 111 PHE n 1 112 GLY n 1 113 GLY n 1 114 LYS n 1 115 LEU n 1 116 PRO n 1 117 SER n 1 118 SER n 1 119 GLN n 1 120 ASN n 1 121 GLU n 1 122 LEU n 1 123 GLU n 1 124 ASN n 1 125 VAL n 1 126 PHE n 1 127 LYS n 1 128 ALA n 1 129 TRP n 1 130 GLY n 1 131 ALA n 1 132 ALA n 1 133 ASN n 1 134 LYS n 1 135 TYR n 1 136 GLU n 1 137 TYR n 1 138 TYR n 1 139 LYS n 1 140 SER n 1 141 SER n 1 142 GLN n 1 143 THR n 1 144 ILE n 1 145 ILE n 1 146 SER n 1 147 TRP n 1 148 VAL n 1 149 GLN n 1 150 GLN n 1 151 THR n 1 152 ALA n 1 153 GLN n 1 154 ASP n 1 155 ALA n 1 156 LYS n 1 157 SER n 1 158 GLY n 1 159 VAL n 1 160 ALA n 1 161 SER n 1 162 THR n 1 163 TYR n 1 164 ASP n 1 165 LEU n 1 166 VAL n 1 167 LYS n 1 168 GLN n 1 169 ASN n 1 170 PRO n 1 171 LEU n 1 172 ASN n 1 173 ASN n 1 174 ILE n 1 175 LYS n 1 176 ALA n 1 177 SER n 1 178 GLU n 1 179 SER n 1 180 ASN n 1 181 ALA n 1 182 TYR n 1 183 ALA n 1 184 THR n 1 185 CYS n 1 186 VAL n 1 187 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene EAE _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ENTEROPATHOGENIC SEROTYPE O127:H6' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant 'STRAIN E2348/69' _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell BACTERIAL _entity_src_gen.pdbx_gene_src_cellular_location 'OUTER MEMBRANE/SURFACE' _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene 'EAE [TRUNCATION]' _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET3A/PLYSS _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description RECOMBINANT # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EAE1_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P19809 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1E1B _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 187 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P19809 _struct_ref_seq.db_align_beg 753 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 939 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 187 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 HSQC 1 2 1 'TRIPLE RESONANCE' 1 3 1 15N-NOESY 1 4 1 13C-NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 5.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20 MM ACETATE' _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX500 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1E1B _pdbx_nmr_refine.method 'HYBRID TORSION ANGLE/ CARTESIAN CO-ORDINATE DYNAMICS' _pdbx_nmr_refine.details 'INT190 IS A TRUNCATION OF INT280 (30KDA) WHOSE GLOBAL FOLD WAS PUBLISHED IN NATURE STRUCTURAL BIOLOGY (1999) VOL.6, PP. 313-318.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1E1B _pdbx_nmr_details.text ;REPRESENTATIVE STRUCTURE, LEAST ENERGY. RESONANCE ASSIGNMENTS MADE USING TRIPLE RESONANCE EXPERIMENTS WERE FOLLOWED BY COLLATION OF DISTANCE RESTRAINTS USING NOESY EXPERIMENTS ON 15N,13C-LABELLED INT190 ; # _pdbx_nmr_ensemble.entry_id 1E1B _pdbx_nmr_ensemble.conformers_calculated_total_number 15 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST ENERGY' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR ? ? 1 'structure solution' XWIN-NMR ? ? 2 'structure solution' AURELIA ? ? 3 'structure solution' X-PLOR ? ? 4 # _exptl.entry_id 1E1B _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1E1B _struct.title 'NMR Representative Structure of Intimin-190 (Int190) from Enteropathogenic E. coli' _struct.pdbx_descriptor INTIMIN _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1E1B _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'INTIMIN, ESCHERICHIA COLI, CELL ADHESION, OUTER MEMBRANE PROTEIN, NMR SPECTROSCOPY, MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 I TYR A 101 ? ASN A 110 ? TYR A 101 ASN A 110 1 ? 10 HELX_P HELX_P2 II GLN A 119 ? TRP A 129 ? GLN A 119 TRP A 129 1 ? 11 HELX_P HELX_P3 III TYR A 135 ? SER A 140 ? TYR A 135 SER A 140 5 'SEE REMARK 650' 6 HELX_P HELX_P4 IV ALA A 152 ? SER A 157 ? ALA A 152 SER A 157 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 108 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 185 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 108 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 185 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.021 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details 3A1 ? 1 ? 3A2 ? 1 ? 3A ? 4 ? 3B ? 3 ? 4A1 ? 1 ? 4A ? 2 ? 4A2 ? 1 ? 4B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense 3A 1 2 ? anti-parallel 3A 2 3 ? anti-parallel 3A 3 4 ? anti-parallel 3B 1 2 ? anti-parallel 3B 2 3 ? anti-parallel 4A 1 2 ? anti-parallel 4B 1 2 ? anti-parallel 4B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id 3A1 1 LEU A 2 ? ASP A 5 ? LEU A 2 ASP A 5 3A2 1 LYS A 17 ? LEU A 20 ? LYS A 17 LEU A 20 3A 1 ASN A 8 ? ILE A 11 ? ASN A 8 ILE A 11 3A 2 GLN A 29 ? ALA A 34 ? GLN A 29 ALA A 34 3A 3 GLY A 58 ? LEU A 62 ? GLY A 58 LEU A 62 3A 4 ALA A 51 ? ASP A 54 ? ALA A 51 ASP A 54 3B 1 LYS A 40 ? SER A 45 ? LYS A 40 SER A 45 3B 2 THR A 67 ? SER A 74 ? THR A 67 SER A 74 3B 3 THR A 79 ? THR A 83 ? THR A 79 THR A 83 4A1 1 LYS A 114 ? PRO A 116 ? LYS A 114 PRO A 116 4A 1 ALA A 183 ? VAL A 186 ? ALA A 183 VAL A 186 4A 2 SER A 89 ? PRO A 93 ? SER A 89 PRO A 93 4A2 1 VAL A 23 ? LEU A 25 ? VAL A 23 LEU A 25 4B 1 THR A 143 ? VAL A 148 ? THR A 143 VAL A 148 4B 2 VAL A 159 ? ASP A 164 ? VAL A 159 ASP A 164 4B 3 PRO A 170 ? ASN A 172 ? PRO A 170 ASN A 172 # _database_PDB_matrix.entry_id 1E1B _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1E1B _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 1 THR THR A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 CYS 108 108 108 CYS CYS A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 TRP 129 129 129 TRP TRP A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 TYR 135 135 135 TYR TYR A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 TYR 138 138 138 TYR TYR A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 GLN 142 142 142 GLN GLN A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 TRP 147 147 147 TRP TRP A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 SER 157 157 157 SER SER A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 SER 161 161 161 SER SER A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 TYR 163 163 163 TYR TYR A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 GLN 168 168 168 GLN GLN A . n A 1 169 ASN 169 169 169 ASN ASN A . n A 1 170 PRO 170 170 170 PRO PRO A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 ASN 172 172 172 ASN ASN A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 ILE 174 174 174 ILE ILE A . n A 1 175 LYS 175 175 175 LYS LYS A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 ASN 180 180 180 ASN ASN A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 TYR 182 182 182 TYR TYR A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 THR 184 184 184 THR THR A . n A 1 185 CYS 185 185 185 CYS CYS A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 LYS 187 187 187 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-05-21 2 'Structure model' 1 1 2000-10-03 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ; HELIX DETERMINATION METHOD: AUTHOR-DETERMINED HELIX_ID: III,POSSIBLE 3/10 HELIX - NOT ENOUGH DATA. ; 700 ; SHEET DETERMINATION METHOD: AUTHOR-DETERMINED ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LYS 40 ? ? H A SER 75 ? ? 1.35 2 1 O A VAL 99 ? ? H A ASN 180 ? ? 1.48 3 1 O A LYS 134 ? ? H A GLU 136 ? ? 1.50 4 1 2HB A TRP 24 ? ? O A SER 89 ? ? 1.50 5 1 O A THR 162 ? ? H A LEU 171 ? ? 1.51 6 1 O A PRO 93 ? ? 2HD2 A ASN 94 ? ? 1.56 7 1 O A ILE 70 ? ? H A TYR 82 ? ? 1.57 8 1 H A THR 162 ? ? O A LEU 171 ? ? 1.59 9 1 O A THR 42 ? ? H A ILE 73 ? ? 1.59 10 1 H A THR 42 ? ? O A ILE 73 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 12 ? ? 65.81 -14.72 2 1 VAL A 16 ? ? 160.22 147.14 3 1 PRO A 21 ? ? -75.49 -92.24 4 1 THR A 22 ? ? -150.16 -32.42 5 1 GLN A 26 ? ? 47.19 158.82 6 1 ALA A 46 ? ? 59.33 -16.55 7 1 ASN A 47 ? ? 134.65 153.56 8 1 SER A 57 ? ? 158.85 62.13 9 1 GLU A 64 ? ? 173.36 140.89 10 1 LYS A 65 ? ? 164.78 -86.64 11 1 ASP A 76 ? ? -56.23 -5.02 12 1 ASN A 77 ? ? 92.43 32.27 13 1 ALA A 85 ? ? -135.59 -58.44 14 1 MET A 95 ? ? -172.91 83.05 15 1 ARG A 98 ? ? -30.51 123.57 16 1 ALA A 131 ? ? -69.76 -116.08 17 1 TYR A 135 ? ? 54.95 -68.28 18 1 GLN A 142 ? ? 72.55 -55.32 19 1 GLN A 150 ? ? -106.23 -146.30 20 1 GLN A 168 ? ? 93.41 15.60 21 1 ASN A 169 ? ? 155.25 168.68 22 1 ASN A 173 ? ? 70.77 74.48 23 1 LYS A 175 ? ? -39.03 102.47 24 1 GLU A 178 ? ? -178.65 -179.00 25 1 SER A 179 ? ? 39.86 87.90 26 1 ALA A 181 ? ? 166.12 -95.33 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 98 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.274 _pdbx_validate_planes.type 'SIDE CHAIN' #