data_1E5W # _entry.id 1E5W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1E5W PDBE EBI-5226 WWPDB D_1290005226 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1EF1 _pdbx_database_related.content_type unspecified _pdbx_database_related.details 'CRYSTAL STRUCTURE OF THE MOESIN FERM DOMAIN/TAIL DOMAIN COMPLEX' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1E5W _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2000-08-03 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Edwards, S.D.' 1 'Keep, N.H.' 2 # _citation.id primary _citation.title 'The 2.7 A Crystal Structure of the Activated Ferm Domain of Moesin: An Analysis of Structural Changes on Activation' _citation.journal_abbrev Biochemistry _citation.journal_volume 40 _citation.page_first 7061 _citation.page_last ? _citation.year 2001 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11401550 _citation.pdbx_database_id_DOI 10.1021/BI010419H # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Edwards, S.D.' 1 primary 'Keep, N.H.' 2 # _cell.entry_id 1E5W _cell.length_a 94.360 _cell.length_b 94.360 _cell.length_c 156.050 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1E5W _symmetry.space_group_name_H-M 'P 42 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 94 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man MOESIN 41054.305 1 ? ? 'FERM DOMAIN AND HELIX RESIDUE 1-345' ? 2 water nat water 18.015 36 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKF RAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQ HKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMER AMLENEKKKREMAEKEKEKIEREKEE ; _entity_poly.pdbx_seq_one_letter_code_can ;MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKF RAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQ HKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMER AMLENEKKKREMAEKEKEKIEREKEE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 LYS n 1 4 THR n 1 5 ILE n 1 6 SER n 1 7 VAL n 1 8 ARG n 1 9 VAL n 1 10 THR n 1 11 THR n 1 12 MET n 1 13 ASP n 1 14 ALA n 1 15 GLU n 1 16 LEU n 1 17 GLU n 1 18 PHE n 1 19 ALA n 1 20 ILE n 1 21 GLN n 1 22 PRO n 1 23 ASN n 1 24 THR n 1 25 THR n 1 26 GLY n 1 27 LYS n 1 28 GLN n 1 29 LEU n 1 30 PHE n 1 31 ASP n 1 32 GLN n 1 33 VAL n 1 34 VAL n 1 35 LYS n 1 36 THR n 1 37 ILE n 1 38 GLY n 1 39 LEU n 1 40 ARG n 1 41 GLU n 1 42 VAL n 1 43 TRP n 1 44 PHE n 1 45 PHE n 1 46 GLY n 1 47 LEU n 1 48 GLN n 1 49 TYR n 1 50 GLN n 1 51 ASP n 1 52 THR n 1 53 LYS n 1 54 GLY n 1 55 PHE n 1 56 SER n 1 57 THR n 1 58 TRP n 1 59 LEU n 1 60 LYS n 1 61 LEU n 1 62 ASN n 1 63 LYS n 1 64 LYS n 1 65 VAL n 1 66 THR n 1 67 ALA n 1 68 GLN n 1 69 ASP n 1 70 VAL n 1 71 ARG n 1 72 LYS n 1 73 GLU n 1 74 SER n 1 75 PRO n 1 76 LEU n 1 77 LEU n 1 78 PHE n 1 79 LYS n 1 80 PHE n 1 81 ARG n 1 82 ALA n 1 83 LYS n 1 84 PHE n 1 85 TYR n 1 86 PRO n 1 87 GLU n 1 88 ASP n 1 89 VAL n 1 90 SER n 1 91 GLU n 1 92 GLU n 1 93 LEU n 1 94 ILE n 1 95 GLN n 1 96 ASP n 1 97 ILE n 1 98 THR n 1 99 GLN n 1 100 ARG n 1 101 LEU n 1 102 PHE n 1 103 PHE n 1 104 LEU n 1 105 GLN n 1 106 VAL n 1 107 LYS n 1 108 GLU n 1 109 GLY n 1 110 ILE n 1 111 LEU n 1 112 ASN n 1 113 ASP n 1 114 ASP n 1 115 ILE n 1 116 TYR n 1 117 CYS n 1 118 PRO n 1 119 PRO n 1 120 GLU n 1 121 THR n 1 122 ALA n 1 123 VAL n 1 124 LEU n 1 125 LEU n 1 126 ALA n 1 127 SER n 1 128 TYR n 1 129 ALA n 1 130 VAL n 1 131 GLN n 1 132 SER n 1 133 LYS n 1 134 TYR n 1 135 GLY n 1 136 ASP n 1 137 PHE n 1 138 ASN n 1 139 LYS n 1 140 GLU n 1 141 VAL n 1 142 HIS n 1 143 LYS n 1 144 SER n 1 145 GLY n 1 146 TYR n 1 147 LEU n 1 148 ALA n 1 149 GLY n 1 150 ASP n 1 151 LYS n 1 152 LEU n 1 153 LEU n 1 154 PRO n 1 155 GLN n 1 156 ARG n 1 157 VAL n 1 158 LEU n 1 159 GLU n 1 160 GLN n 1 161 HIS n 1 162 LYS n 1 163 LEU n 1 164 ASN n 1 165 LYS n 1 166 ASP n 1 167 GLN n 1 168 TRP n 1 169 GLU n 1 170 GLU n 1 171 ARG n 1 172 ILE n 1 173 GLN n 1 174 VAL n 1 175 TRP n 1 176 HIS n 1 177 GLU n 1 178 GLU n 1 179 HIS n 1 180 ARG n 1 181 GLY n 1 182 MET n 1 183 LEU n 1 184 ARG n 1 185 GLU n 1 186 ASP n 1 187 ALA n 1 188 VAL n 1 189 LEU n 1 190 GLU n 1 191 TYR n 1 192 LEU n 1 193 LYS n 1 194 ILE n 1 195 ALA n 1 196 GLN n 1 197 ASP n 1 198 LEU n 1 199 GLU n 1 200 MET n 1 201 TYR n 1 202 GLY n 1 203 VAL n 1 204 ASN n 1 205 TYR n 1 206 PHE n 1 207 SER n 1 208 ILE n 1 209 LYS n 1 210 ASN n 1 211 LYS n 1 212 LYS n 1 213 GLY n 1 214 SER n 1 215 GLU n 1 216 LEU n 1 217 TRP n 1 218 LEU n 1 219 GLY n 1 220 VAL n 1 221 ASP n 1 222 ALA n 1 223 LEU n 1 224 GLY n 1 225 LEU n 1 226 ASN n 1 227 ILE n 1 228 TYR n 1 229 GLU n 1 230 GLN n 1 231 ASN n 1 232 ASP n 1 233 ARG n 1 234 LEU n 1 235 THR n 1 236 PRO n 1 237 LYS n 1 238 ILE n 1 239 GLY n 1 240 PHE n 1 241 PRO n 1 242 TRP n 1 243 SER n 1 244 GLU n 1 245 ILE n 1 246 ARG n 1 247 ASN n 1 248 ILE n 1 249 SER n 1 250 PHE n 1 251 ASN n 1 252 ASP n 1 253 LYS n 1 254 LYS n 1 255 PHE n 1 256 VAL n 1 257 ILE n 1 258 LYS n 1 259 PRO n 1 260 ILE n 1 261 ASP n 1 262 LYS n 1 263 LYS n 1 264 ALA n 1 265 PRO n 1 266 ASP n 1 267 PHE n 1 268 VAL n 1 269 PHE n 1 270 TYR n 1 271 ALA n 1 272 PRO n 1 273 ARG n 1 274 LEU n 1 275 ARG n 1 276 ILE n 1 277 ASN n 1 278 LYS n 1 279 ARG n 1 280 ILE n 1 281 LEU n 1 282 ALA n 1 283 LEU n 1 284 CYS n 1 285 MET n 1 286 GLY n 1 287 ASN n 1 288 HIS n 1 289 GLU n 1 290 LEU n 1 291 TYR n 1 292 MET n 1 293 ARG n 1 294 ARG n 1 295 ARG n 1 296 LYS n 1 297 PRO n 1 298 ASP n 1 299 THR n 1 300 ILE n 1 301 GLU n 1 302 VAL n 1 303 GLN n 1 304 GLN n 1 305 MET n 1 306 LYS n 1 307 ALA n 1 308 GLN n 1 309 ALA n 1 310 ARG n 1 311 GLU n 1 312 GLU n 1 313 LYS n 1 314 HIS n 1 315 GLN n 1 316 LYS n 1 317 GLN n 1 318 MET n 1 319 GLU n 1 320 ARG n 1 321 ALA n 1 322 MET n 1 323 LEU n 1 324 GLU n 1 325 ASN n 1 326 GLU n 1 327 LYS n 1 328 LYS n 1 329 LYS n 1 330 ARG n 1 331 GLU n 1 332 MET n 1 333 ALA n 1 334 GLU n 1 335 LYS n 1 336 GLU n 1 337 LYS n 1 338 GLU n 1 339 LYS n 1 340 ILE n 1 341 GLU n 1 342 ARG n 1 343 GLU n 1 344 LYS n 1 345 GLU n 1 346 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene MOESIN _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant BLR _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'RECOMBINANT EXPRESSION IN E.COLI OF NON-FUSION PROTEIN' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 1E5W 1 ? ? 1E5W ? 2 UNP MOES_HUMAN 1 ? ? P26038 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1E5W A 1 ? 1 ? 1E5W 1 ? 1 ? 1 1 2 2 1E5W A 2 ? 346 ? P26038 1 ? 345 ? 2 346 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1E5W _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 4.23 _exptl_crystal.density_percent_sol 66 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.50 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '25% ETHYLENE GLYCOL, 100MM HEPES PH7.5, 10-15 MG/ML PROTEIN, pH 7.50' # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1999-10-15 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.87 1.0 2 1.3 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SRS BEAMLINE PX9.6' _diffrn_source.pdbx_synchrotron_site SRS _diffrn_source.pdbx_synchrotron_beamline PX9.6 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.87, 1.3' # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1E5W _reflns.observed_criterion_sigma_I 0.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 37.000 _reflns.d_resolution_high 2.700 _reflns.number_obs 19994 _reflns.number_all ? _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs 0.04600 _reflns.pdbx_Rsym_value 0.04600 _reflns.pdbx_netI_over_sigmaI 4.6000 _reflns.B_iso_Wilson_estimate 55.3 _reflns.pdbx_redundancy 5.500 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.70 _reflns_shell.d_res_low 2.85 _reflns_shell.percent_possible_all 99.9 _reflns_shell.Rmerge_I_obs 0.24600 _reflns_shell.pdbx_Rsym_value 0.24600 _reflns_shell.meanI_over_sigI_obs 3.000 _reflns_shell.pdbx_redundancy 5.50 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1E5W _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 19994 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 1200346.62 _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 37.12 _refine.ls_d_res_high 2.70 _refine.ls_percent_reflns_obs 99.7 _refine.ls_R_factor_obs 0.254 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.254 _refine.ls_R_factor_R_free 0.297 _refine.ls_R_factor_R_free_error 0.009 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 1019 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 73.5 _refine.aniso_B[1][1] -5.35 _refine.aniso_B[2][2] -5.35 _refine.aniso_B[3][3] 10.71 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.314713 _refine.solvent_model_param_bsol 38.5186 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 1E5W _refine_analyze.Luzzati_coordinate_error_obs 0.45 _refine_analyze.Luzzati_sigma_a_obs 0.48 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.55 _refine_analyze.Luzzati_sigma_a_free 0.63 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2889 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 36 _refine_hist.number_atoms_total 2925 _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 37.12 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 22.2 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.88 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? 1.5 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? 2.0 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? 2.0 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? 2.5 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.70 _refine_ls_shell.d_res_low 2.87 _refine_ls_shell.number_reflns_R_work 3077 _refine_ls_shell.R_factor_R_work 0.427 _refine_ls_shell.percent_reflns_obs 99.8 _refine_ls_shell.R_factor_R_free 0.450 _refine_ls_shell.R_factor_R_free_error 0.036 _refine_ls_shell.percent_reflns_R_free 4.9 _refine_ls_shell.number_reflns_R_free 160 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM ? # _struct.entry_id 1E5W _struct.title 'Structure of isolated FERM domain and first long helix of moesin' _struct.pdbx_descriptor MOESIN _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1E5W _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'MEMBRANE PROTEIN, MOESIN, FERM, ERM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 25 ? GLY A 38 ? THR A 25 GLY A 38 1 ? 14 HELX_P HELX_P2 2 GLU A 41 ? TRP A 43 ? GLU A 41 TRP A 43 5 ? 3 HELX_P HELX_P3 3 VAL A 65 ? GLN A 68 ? VAL A 65 GLN A 68 5 ? 4 HELX_P HELX_P4 4 ASP A 88 ? LEU A 93 ? ASP A 88 LEU A 93 1 ? 6 HELX_P HELX_P5 5 GLN A 95 ? ASN A 112 ? GLN A 95 ASN A 112 1 ? 18 HELX_P HELX_P6 6 PRO A 118 ? TYR A 134 ? PRO A 118 TYR A 134 1 ? 17 HELX_P HELX_P7 7 ASN A 164 ? GLU A 178 ? ASN A 164 GLU A 178 1 ? 15 HELX_P HELX_P8 8 LEU A 183 ? GLN A 196 ? LEU A 183 GLN A 196 1 ? 14 HELX_P HELX_P9 9 ARG A 273 ? LYS A 296 ? ARG A 273 LYS A 296 1 ? 24 HELX_P HELX_P10 10 ILE A 300 ? LYS A 344 ? ILE A 300 LYS A 344 1 ? 45 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 74 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 74 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 75 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 75 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.27 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 4 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 16 ? GLN A 21 ? LEU A 16 GLN A 21 A 2 THR A 4 ? THR A 10 ? THR A 4 THR A 10 A 3 LEU A 76 ? ALA A 82 ? LEU A 76 ALA A 82 A 4 PHE A 45 ? GLN A 50 ? PHE A 45 GLN A 50 A 5 SER A 56 ? TRP A 58 ? SER A 56 TRP A 58 B 1 ASN A 204 ? LYS A 209 ? ASN A 204 LYS A 209 B 2 GLU A 215 ? ASP A 221 ? GLU A 215 ASP A 221 B 3 GLY A 224 ? GLU A 229 ? GLY A 224 GLU A 229 B 4 PRO A 236 ? PRO A 241 ? PRO A 236 PRO A 241 C 1 PHE A 267 ? TYR A 270 ? PHE A 267 TYR A 270 C 2 LYS A 254 ? PRO A 259 ? LYS A 254 PRO A 259 C 3 ILE A 245 ? PHE A 250 ? ILE A 245 PHE A 250 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 16 ? O LEU A 16 N VAL A 9 ? N VAL A 9 A 2 3 O ARG A 8 ? O ARG A 8 N LEU A 76 ? N LEU A 76 A 3 4 O LYS A 79 ? O LYS A 79 N GLN A 48 ? N GLN A 48 A 4 5 O TYR A 49 ? O TYR A 49 N THR A 57 ? N THR A 57 B 1 2 O ASN A 204 ? O ASN A 204 N VAL A 220 ? N VAL A 220 B 2 3 O TRP A 217 ? O TRP A 217 N TYR A 228 ? N TYR A 228 B 3 4 O LEU A 225 ? O LEU A 225 N PHE A 240 ? N PHE A 240 C 1 2 O PHE A 267 ? O PHE A 267 N ILE A 257 ? N ILE A 257 C 2 3 O VAL A 256 ? O VAL A 256 N SER A 249 ? N SER A 249 # _database_PDB_matrix.entry_id 1E5W _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1E5W _atom_sites.fract_transf_matrix[1][1] 0.010598 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010598 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006408 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 TRP 58 58 58 TRP TRP A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 CYS 117 117 117 CYS CYS A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 GLN 131 131 131 GLN GLN A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 TYR 134 134 134 TYR TYR A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 HIS 142 142 142 HIS HIS A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 PRO 154 154 154 PRO PRO A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 GLN 160 160 160 GLN GLN A . n A 1 161 HIS 161 161 161 HIS HIS A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 ASN 164 164 164 ASN ASN A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 GLN 167 167 167 GLN GLN A . n A 1 168 TRP 168 168 168 TRP TRP A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 ARG 171 171 171 ARG ARG A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 GLN 173 173 173 GLN GLN A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 TRP 175 175 175 TRP TRP A . n A 1 176 HIS 176 176 176 HIS HIS A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 HIS 179 179 179 HIS HIS A . n A 1 180 ARG 180 180 180 ARG ARG A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 MET 182 182 182 MET MET A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 ARG 184 184 184 ARG ARG A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 TYR 191 191 191 TYR TYR A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 LYS 193 193 193 LYS LYS A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 GLN 196 196 196 GLN GLN A . n A 1 197 ASP 197 197 197 ASP ASP A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 MET 200 200 200 MET MET A . n A 1 201 TYR 201 201 201 TYR TYR A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 ASN 204 204 204 ASN ASN A . n A 1 205 TYR 205 205 205 TYR TYR A . n A 1 206 PHE 206 206 206 PHE PHE A . n A 1 207 SER 207 207 207 SER SER A . n A 1 208 ILE 208 208 208 ILE ILE A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 ASN 210 210 210 ASN ASN A . n A 1 211 LYS 211 211 211 LYS LYS A . n A 1 212 LYS 212 212 212 LYS LYS A . n A 1 213 GLY 213 213 213 GLY GLY A . n A 1 214 SER 214 214 214 SER SER A . n A 1 215 GLU 215 215 215 GLU GLU A . n A 1 216 LEU 216 216 216 LEU LEU A . n A 1 217 TRP 217 217 217 TRP TRP A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 GLY 219 219 219 GLY GLY A . n A 1 220 VAL 220 220 220 VAL VAL A . n A 1 221 ASP 221 221 221 ASP ASP A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 GLY 224 224 224 GLY GLY A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 ASN 226 226 226 ASN ASN A . n A 1 227 ILE 227 227 227 ILE ILE A . n A 1 228 TYR 228 228 228 TYR TYR A . n A 1 229 GLU 229 229 229 GLU GLU A . n A 1 230 GLN 230 230 230 GLN GLN A . n A 1 231 ASN 231 231 231 ASN ASN A . n A 1 232 ASP 232 232 232 ASP ASP A . n A 1 233 ARG 233 233 233 ARG ARG A . n A 1 234 LEU 234 234 234 LEU LEU A . n A 1 235 THR 235 235 235 THR THR A . n A 1 236 PRO 236 236 236 PRO PRO A . n A 1 237 LYS 237 237 237 LYS LYS A . n A 1 238 ILE 238 238 238 ILE ILE A . n A 1 239 GLY 239 239 239 GLY GLY A . n A 1 240 PHE 240 240 240 PHE PHE A . n A 1 241 PRO 241 241 241 PRO PRO A . n A 1 242 TRP 242 242 242 TRP TRP A . n A 1 243 SER 243 243 243 SER SER A . n A 1 244 GLU 244 244 244 GLU GLU A . n A 1 245 ILE 245 245 245 ILE ILE A . n A 1 246 ARG 246 246 246 ARG ARG A . n A 1 247 ASN 247 247 247 ASN ASN A . n A 1 248 ILE 248 248 248 ILE ILE A . n A 1 249 SER 249 249 249 SER SER A . n A 1 250 PHE 250 250 250 PHE PHE A . n A 1 251 ASN 251 251 251 ASN ASN A . n A 1 252 ASP 252 252 252 ASP ASP A . n A 1 253 LYS 253 253 253 LYS LYS A . n A 1 254 LYS 254 254 254 LYS LYS A . n A 1 255 PHE 255 255 255 PHE PHE A . n A 1 256 VAL 256 256 256 VAL VAL A . n A 1 257 ILE 257 257 257 ILE ILE A . n A 1 258 LYS 258 258 258 LYS LYS A . n A 1 259 PRO 259 259 259 PRO PRO A . n A 1 260 ILE 260 260 260 ILE ILE A . n A 1 261 ASP 261 261 261 ASP ASP A . n A 1 262 LYS 262 262 262 LYS LYS A . n A 1 263 LYS 263 263 263 LYS LYS A . n A 1 264 ALA 264 264 264 ALA ALA A . n A 1 265 PRO 265 265 265 PRO PRO A . n A 1 266 ASP 266 266 266 ASP ASP A . n A 1 267 PHE 267 267 267 PHE PHE A . n A 1 268 VAL 268 268 268 VAL VAL A . n A 1 269 PHE 269 269 269 PHE PHE A . n A 1 270 TYR 270 270 270 TYR TYR A . n A 1 271 ALA 271 271 271 ALA ALA A . n A 1 272 PRO 272 272 272 PRO PRO A . n A 1 273 ARG 273 273 273 ARG ARG A . n A 1 274 LEU 274 274 274 LEU LEU A . n A 1 275 ARG 275 275 275 ARG ARG A . n A 1 276 ILE 276 276 276 ILE ILE A . n A 1 277 ASN 277 277 277 ASN ASN A . n A 1 278 LYS 278 278 278 LYS LYS A . n A 1 279 ARG 279 279 279 ARG ARG A . n A 1 280 ILE 280 280 280 ILE ILE A . n A 1 281 LEU 281 281 281 LEU LEU A . n A 1 282 ALA 282 282 282 ALA ALA A . n A 1 283 LEU 283 283 283 LEU LEU A . n A 1 284 CYS 284 284 284 CYS CYS A . n A 1 285 MET 285 285 285 MET MET A . n A 1 286 GLY 286 286 286 GLY GLY A . n A 1 287 ASN 287 287 287 ASN ASN A . n A 1 288 HIS 288 288 288 HIS HIS A . n A 1 289 GLU 289 289 289 GLU GLU A . n A 1 290 LEU 290 290 290 LEU LEU A . n A 1 291 TYR 291 291 291 TYR TYR A . n A 1 292 MET 292 292 292 MET MET A . n A 1 293 ARG 293 293 293 ARG ARG A . n A 1 294 ARG 294 294 294 ARG ARG A . n A 1 295 ARG 295 295 295 ARG ARG A . n A 1 296 LYS 296 296 296 LYS LYS A . n A 1 297 PRO 297 297 297 PRO PRO A . n A 1 298 ASP 298 298 298 ASP ASP A . n A 1 299 THR 299 299 299 THR THR A . n A 1 300 ILE 300 300 300 ILE ILE A . n A 1 301 GLU 301 301 301 GLU GLU A . n A 1 302 VAL 302 302 302 VAL VAL A . n A 1 303 GLN 303 303 303 GLN GLN A . n A 1 304 GLN 304 304 304 GLN GLN A . n A 1 305 MET 305 305 305 MET MET A . n A 1 306 LYS 306 306 306 LYS LYS A . n A 1 307 ALA 307 307 307 ALA ALA A . n A 1 308 GLN 308 308 308 GLN GLN A . n A 1 309 ALA 309 309 309 ALA ALA A . n A 1 310 ARG 310 310 310 ARG ARG A . n A 1 311 GLU 311 311 311 GLU GLU A . n A 1 312 GLU 312 312 312 GLU GLU A . n A 1 313 LYS 313 313 313 LYS LYS A . n A 1 314 HIS 314 314 314 HIS HIS A . n A 1 315 GLN 315 315 315 GLN GLN A . n A 1 316 LYS 316 316 316 LYS LYS A . n A 1 317 GLN 317 317 317 GLN GLN A . n A 1 318 MET 318 318 318 MET MET A . n A 1 319 GLU 319 319 319 GLU GLU A . n A 1 320 ARG 320 320 320 ARG ARG A . n A 1 321 ALA 321 321 321 ALA ALA A . n A 1 322 MET 322 322 322 MET MET A . n A 1 323 LEU 323 323 323 LEU LEU A . n A 1 324 GLU 324 324 324 GLU GLU A . n A 1 325 ASN 325 325 325 ASN ASN A . n A 1 326 GLU 326 326 326 GLU GLU A . n A 1 327 LYS 327 327 327 LYS LYS A . n A 1 328 LYS 328 328 328 LYS LYS A . n A 1 329 LYS 329 329 329 LYS LYS A . n A 1 330 ARG 330 330 330 ARG ARG A . n A 1 331 GLU 331 331 331 GLU GLU A . n A 1 332 MET 332 332 332 MET MET A . n A 1 333 ALA 333 333 333 ALA ALA A . n A 1 334 GLU 334 334 334 GLU GLU A . n A 1 335 LYS 335 335 335 LYS LYS A . n A 1 336 GLU 336 336 336 GLU GLU A . n A 1 337 LYS 337 337 337 LYS LYS A . n A 1 338 GLU 338 338 338 GLU GLU A . n A 1 339 LYS 339 339 339 LYS LYS A . n A 1 340 ILE 340 340 340 ILE ILE A . n A 1 341 GLU 341 341 341 GLU GLU A . n A 1 342 ARG 342 342 342 ARG ARG A . n A 1 343 GLU 343 343 343 GLU GLU A . n A 1 344 LYS 344 344 344 LYS LYS A . n A 1 345 GLU 345 345 345 GLU GLU A . n A 1 346 GLU 346 346 346 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 2001 2001 HOH HOH A . B 2 HOH 2 2002 2002 HOH HOH A . B 2 HOH 3 2003 2003 HOH HOH A . B 2 HOH 4 2004 2004 HOH HOH A . B 2 HOH 5 2005 2005 HOH HOH A . B 2 HOH 6 2006 2006 HOH HOH A . B 2 HOH 7 2007 2007 HOH HOH A . B 2 HOH 8 2008 2008 HOH HOH A . B 2 HOH 9 2009 2009 HOH HOH A . B 2 HOH 10 2010 2010 HOH HOH A . B 2 HOH 11 2011 2011 HOH HOH A . B 2 HOH 12 2012 2012 HOH HOH A . B 2 HOH 13 2013 2013 HOH HOH A . B 2 HOH 14 2014 2014 HOH HOH A . B 2 HOH 15 2015 2015 HOH HOH A . B 2 HOH 16 2016 2016 HOH HOH A . B 2 HOH 17 2017 2017 HOH HOH A . B 2 HOH 18 2018 2018 HOH HOH A . B 2 HOH 19 2019 2019 HOH HOH A . B 2 HOH 20 2020 2020 HOH HOH A . B 2 HOH 21 2021 2021 HOH HOH A . B 2 HOH 22 2022 2022 HOH HOH A . B 2 HOH 23 2023 2023 HOH HOH A . B 2 HOH 24 2024 2024 HOH HOH A . B 2 HOH 25 2025 2025 HOH HOH A . B 2 HOH 26 2026 2026 HOH HOH A . B 2 HOH 27 2027 2027 HOH HOH A . B 2 HOH 28 2028 2028 HOH HOH A . B 2 HOH 29 2029 2029 HOH HOH A . B 2 HOH 30 2030 2030 HOH HOH A . B 2 HOH 31 2031 2031 HOH HOH A . B 2 HOH 32 2032 2032 HOH HOH A . B 2 HOH 33 2033 2033 HOH HOH A . B 2 HOH 34 2034 2034 HOH HOH A . B 2 HOH 35 2035 2035 HOH HOH A . B 2 HOH 36 2036 2036 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-06-27 2 'Structure model' 1 1 2015-02-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' 'Non-polymer description' 4 2 'Structure model' Other 5 2 'Structure model' 'Refinement description' 6 2 'Structure model' 'Source and taxonomy' 7 2 'Structure model' 'Structure summary' 8 2 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MOSFLM 'data reduction' . ? 1 SCALA 'data scaling' . ? 2 SOLVE phasing . ? 3 SHARP phasing . ? 4 CNS refinement 1.0 ? 5 # _pdbx_entry_details.entry_id 1E5W _pdbx_entry_details.compound_details ;PROBABLY INVOLVED IN ANCHORING OF MAJOR CYTOSKELETAL STRUCTURES TO THE PLASMA MEMBRANE. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2 ? ? 12.05 137.36 2 1 THR A 36 ? ? -51.34 -70.30 3 1 GLU A 41 ? ? -90.51 58.62 4 1 ASP A 69 ? ? -24.29 93.22 5 1 SER A 144 ? ? -21.64 131.78 6 1 ALA A 148 ? ? -47.15 -7.84 7 1 LEU A 158 ? ? -72.00 -169.91 8 1 GLU A 159 ? ? 77.73 -19.34 9 1 HIS A 161 ? ? -147.08 28.26 10 1 GLU A 169 ? ? -59.47 -9.51 11 1 ALA A 222 ? ? -57.80 -4.74 12 1 PHE A 240 ? ? -156.51 65.51 13 1 ASN A 247 ? ? -178.28 128.53 14 1 ASN A 251 ? ? -153.08 84.84 15 1 ASP A 252 ? ? 46.32 79.04 16 1 LYS A 253 ? ? 84.84 1.99 17 1 LYS A 262 ? ? -17.73 82.00 18 1 LYS A 263 ? ? 8.20 71.95 19 1 PRO A 265 ? ? -62.20 -137.67 20 1 PRO A 272 ? ? -55.51 -74.40 21 1 THR A 299 ? ? -72.44 -148.54 22 1 GLN A 308 ? ? -65.80 9.42 23 1 GLU A 326 ? ? -67.71 18.58 24 1 LYS A 327 ? ? -147.98 -19.27 25 1 LYS A 339 ? ? -37.14 -36.08 26 1 GLU A 345 ? ? -105.36 68.78 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #