data_1E8B # _entry.id 1E8B # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1E8B PDBE EBI-5375 WWPDB D_1290005375 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1E88 _pdbx_database_related.content_type unspecified _pdbx_database_related.details 'SOLUTION STRUCTURE OF 6F11F22F2, A COMPACT THREE-MODULE FRAGMENT OF THE GELATIN-BINDING DOMAIN OF HUMAN FIBRONECTIN' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1E8B _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2000-09-18 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pickford, A.R.' 1 'Smith, S.P.' 2 'Staunton, D.' 3 'Boyd, J.' 4 'Campbell, I.D.' 5 # _citation.id primary _citation.title 'The Hairpin Structure of the (6)F1(1)F2(2)F2 Fragment from Human Fibronectin Enhances Gelatin Binding' _citation.journal_abbrev 'Embo J.' _citation.journal_volume 20 _citation.page_first 1519 _citation.page_last ? _citation.year 2001 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11285216 _citation.pdbx_database_id_DOI 10.1093/EMBOJ/20.7.1519 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pickford, A.R.' 1 ? primary 'Smith, S.P.' 2 ? primary 'Staunton, D.' 3 ? primary 'Boyd, J.' 4 ? primary 'Campbell, I.D.' 5 ? # _cell.entry_id 1E8B _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1E8B _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man FIBRONECTIN 17871.625 1 ? ? '6F11F22F2, RESIDUES 305-464' ? 2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'FN, COLD-INSOLUBLE GLOBULIN, CIG,' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;YGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHL WCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMA ; _entity_poly.pdbx_seq_one_letter_code_can ;YGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHL WCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TYR n 1 2 GLY n 1 3 HIS n 1 4 CYS n 1 5 VAL n 1 6 THR n 1 7 ASP n 1 8 SER n 1 9 GLY n 1 10 VAL n 1 11 VAL n 1 12 TYR n 1 13 SER n 1 14 VAL n 1 15 GLY n 1 16 MET n 1 17 GLN n 1 18 TRP n 1 19 LEU n 1 20 LYS n 1 21 THR n 1 22 GLN n 1 23 GLY n 1 24 ASN n 1 25 LYS n 1 26 GLN n 1 27 MET n 1 28 LEU n 1 29 CYS n 1 30 THR n 1 31 CYS n 1 32 LEU n 1 33 GLY n 1 34 ASN n 1 35 GLY n 1 36 VAL n 1 37 SER n 1 38 CYS n 1 39 GLN n 1 40 GLU n 1 41 THR n 1 42 ALA n 1 43 VAL n 1 44 THR n 1 45 GLN n 1 46 THR n 1 47 TYR n 1 48 GLY n 1 49 GLY n 1 50 ASN n 1 51 SER n 1 52 ASN n 1 53 GLY n 1 54 GLU n 1 55 PRO n 1 56 CYS n 1 57 VAL n 1 58 LEU n 1 59 PRO n 1 60 PHE n 1 61 THR n 1 62 TYR n 1 63 ASN n 1 64 GLY n 1 65 ARG n 1 66 THR n 1 67 PHE n 1 68 TYR n 1 69 SER n 1 70 CYS n 1 71 THR n 1 72 THR n 1 73 GLU n 1 74 GLY n 1 75 ARG n 1 76 GLN n 1 77 ASP n 1 78 GLY n 1 79 HIS n 1 80 LEU n 1 81 TRP n 1 82 CYS n 1 83 SER n 1 84 THR n 1 85 THR n 1 86 SER n 1 87 ASN n 1 88 TYR n 1 89 GLU n 1 90 GLN n 1 91 ASP n 1 92 GLN n 1 93 LYS n 1 94 TYR n 1 95 SER n 1 96 PHE n 1 97 CYS n 1 98 THR n 1 99 ASP n 1 100 HIS n 1 101 THR n 1 102 VAL n 1 103 LEU n 1 104 VAL n 1 105 GLN n 1 106 THR n 1 107 ARG n 1 108 GLY n 1 109 GLY n 1 110 ASN n 1 111 SER n 1 112 ASN n 1 113 GLY n 1 114 ALA n 1 115 LEU n 1 116 CYS n 1 117 HIS n 1 118 PHE n 1 119 PRO n 1 120 PHE n 1 121 LEU n 1 122 TYR n 1 123 ASN n 1 124 ASN n 1 125 HIS n 1 126 ASN n 1 127 TYR n 1 128 THR n 1 129 ASP n 1 130 CYS n 1 131 THR n 1 132 SER n 1 133 GLU n 1 134 GLY n 1 135 ARG n 1 136 ARG n 1 137 ASP n 1 138 ASN n 1 139 MET n 1 140 LYS n 1 141 TRP n 1 142 CYS n 1 143 GLY n 1 144 THR n 1 145 THR n 1 146 GLN n 1 147 ASN n 1 148 TYR n 1 149 ASP n 1 150 ALA n 1 151 ASP n 1 152 GLN n 1 153 LYS n 1 154 PHE n 1 155 GLY n 1 156 PHE n 1 157 CYS n 1 158 PRO n 1 159 MET n 1 160 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location EXTRACELLULAR _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'PICHIA PASTORIS' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain GS115 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location SECRETED _entity_src_gen.pdbx_host_org_vector_type 'INTEGRATED PLASMID' _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PPIC9K _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FINC_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P02751 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1E8B _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 160 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02751 _struct_ref_seq.db_align_beg 305 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 464 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 160 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D [1H-1H] NOESY (60MS MIXIMG TIME)' 1 2 1 '3D [1H-15N] NOESY (60MS MIXING TIME)' 1 3 1 HMQC-J. 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2MM 6F11F22F2, 20MM PHOSPHATE BUFFER' _pdbx_nmr_sample_details.solvent_system ? _pdbx_nmr_sample_details.label ? _pdbx_nmr_sample_details.type ? _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model ? _pdbx_nmr_spectrometer.manufacturer Oxford _pdbx_nmr_spectrometer.field_strength 750 _pdbx_nmr_spectrometer.type 'HOME-BUILT SPECTROMETER INCORPORATING OXFORD INSTRUMENTS MAGNET' # _pdbx_nmr_refine.entry_id 1E8B _pdbx_nmr_refine.method 'AB INITIO SIMULATED ANNEALING' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1E8B _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED BY HETERONUCLEAR NMR SPECTROSCOPY ON UNIFORMLY 15N-LABELED 6F11F22F2.' # _pdbx_nmr_ensemble.entry_id 1E8B _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS 0.9 'BRUNGER ET AL.' 1 'structure solution' Felix 2.3 ? 2 'structure solution' NMRView ? ? 3 'structure solution' CNS ? ? 4 # _exptl.entry_id 1E8B _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1E8B _struct.title 'Solution structure of 6F11F22F2, a compact three-module fragment of the gelatin-binding domain of human fibronectin' _struct.pdbx_descriptor FIBRONECTIN _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'MINIMIZED AVERAGE' # _struct_keywords.entry_id 1E8B _struct_keywords.pdbx_keywords 'CELL ADHESION' _struct_keywords.text 'EXTRACELLULAR MATRIX GLYCOPROTEIN, CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 87 ? GLN A 92 ? ASN A 87 GLN A 92 1 ? 6 HELX_P HELX_P2 2 ASN A 147 ? GLN A 152 ? ASN A 147 GLN A 152 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 4 A CYS 31 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf2 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 29 A CYS 38 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf3 disulf ? ? A CYS 56 SG ? ? ? 1_555 A CYS 82 SG ? ? A CYS 56 A CYS 82 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf4 disulf ? ? A CYS 70 SG ? ? ? 1_555 A CYS 97 SG ? ? A CYS 70 A CYS 97 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf5 disulf ? ? A CYS 116 SG ? ? ? 1_555 A CYS 142 SG ? ? A CYS 116 A CYS 142 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf6 disulf ? ? A CYS 130 SG ? ? ? 1_555 A CYS 157 SG ? ? A CYS 130 A CYS 157 1_555 ? ? ? ? ? ? ? 2.030 ? ? covale1 covale one ? A ASN 126 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 126 A NAG 161 1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 58 A . ? LEU 58 A PRO 59 A ? PRO 59 A 1 0.00 2 PHE 118 A . ? PHE 118 A PRO 119 A ? PRO 119 A 1 -0.04 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? C ? 2 ? D ? 2 ? E ? 2 ? F ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel E 1 2 ? anti-parallel F 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 4 ? THR A 6 ? CYS A 4 THR A 6 A 2 VAL A 10 ? TYR A 12 ? VAL A 10 TYR A 12 B 1 MET A 16 ? THR A 21 ? MET A 16 THR A 21 B 2 GLN A 26 ? CYS A 31 ? GLN A 26 CYS A 31 B 3 VAL A 36 ? GLU A 40 ? VAL A 36 GLU A 40 C 1 PHE A 60 ? TYR A 62 ? PHE A 60 TYR A 62 C 2 ARG A 65 ? PHE A 67 ? ARG A 65 PHE A 67 D 1 TRP A 81 ? SER A 83 ? TRP A 81 SER A 83 D 2 TYR A 94 ? PHE A 96 ? TYR A 94 PHE A 96 E 1 PHE A 120 ? TYR A 122 ? PHE A 120 TYR A 122 E 2 HIS A 125 ? TYR A 127 ? HIS A 125 TYR A 127 F 1 TRP A 141 ? GLY A 143 ? TRP A 141 GLY A 143 F 2 PHE A 154 ? PHE A 156 ? PHE A 154 PHE A 156 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O CYS A 4 ? O CYS A 4 N TYR A 12 ? N TYR A 12 B 1 2 O MET A 16 ? O MET A 16 N CYS A 31 ? N CYS A 31 B 2 3 O LEU A 28 ? O LEU A 28 N GLN A 39 ? N GLN A 39 C 1 2 O PHE A 60 ? O PHE A 60 N PHE A 67 ? N PHE A 67 D 1 2 O CYS A 82 ? O CYS A 82 N SER A 95 ? N SER A 95 E 1 2 O PHE A 120 ? O PHE A 120 N TYR A 127 ? N TYR A 127 F 1 2 O CYS A 142 ? O CYS A 142 N GLY A 155 ? N GLY A 155 # _database_PDB_matrix.entry_id 1E8B _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1E8B _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TYR 1 1 1 TYR TYR A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 TRP 18 18 18 TRP TRP A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 TRP 81 81 81 TRP TRP A . n A 1 82 CYS 82 82 82 CYS CYS A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 CYS 97 97 97 CYS CYS A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 CYS 116 116 116 CYS CYS A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 MET 139 139 139 MET MET A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 TRP 141 141 141 TRP TRP A . n A 1 142 CYS 142 142 142 CYS CYS A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 ASN 147 147 147 ASN ASN A . n A 1 148 TYR 148 148 148 TYR TYR A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 CYS 157 157 157 CYS CYS A . n A 1 158 PRO 158 158 158 PRO PRO A . n A 1 159 MET 159 159 159 MET MET A . n A 1 160 ALA 160 160 160 ALA ALA A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id NAG _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 161 _pdbx_nonpoly_scheme.auth_seq_num 161 _pdbx_nonpoly_scheme.pdb_mon_id NAG _pdbx_nonpoly_scheme.auth_mon_id NAG _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id ASN _pdbx_struct_mod_residue.label_seq_id 126 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id ASN _pdbx_struct_mod_residue.auth_seq_id 126 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id ASN _pdbx_struct_mod_residue.details 'GLYCOSYLATION SITE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-10-15 2 'Structure model' 1 1 2011-10-26 3 'Structure model' 1 2 2012-11-28 4 'Structure model' 1 3 2018-02-14 5 'Structure model' 1 4 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Non-polymer description' 2 2 'Structure model' Other 3 2 'Structure model' 'Structure summary' 4 2 'Structure model' 'Version format compliance' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Data collection' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Derived calculations' 10 5 'Structure model' Other 11 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_nmr_spectrometer 2 5 'Structure model' chem_comp 3 5 'Structure model' entity 4 5 'Structure model' pdbx_chem_comp_identifier 5 5 'Structure model' pdbx_database_status 6 5 'Structure model' pdbx_entity_nonpoly 7 5 'Structure model' pdbx_nmr_software 8 5 'Structure model' struct_conn 9 5 'Structure model' struct_site 10 5 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_nmr_spectrometer.manufacturer' 2 4 'Structure model' '_pdbx_nmr_spectrometer.type' 3 5 'Structure model' '_chem_comp.name' 4 5 'Structure model' '_chem_comp.type' 5 5 'Structure model' '_entity.pdbx_description' 6 5 'Structure model' '_pdbx_database_status.status_code_mr' 7 5 'Structure model' '_pdbx_entity_nonpoly.name' 8 5 'Structure model' '_pdbx_nmr_software.name' 9 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 10 5 'Structure model' '_struct_conn.pdbx_role' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A TYR 148 ? ? H A GLN 152 ? ? 1.58 2 1 O A THR 30 ? ? H A SER 37 ? ? 1.58 3 1 O A GLU 40 ? ? H A ALA 42 ? ? 1.58 4 1 O A THR 72 ? ? H A ARG 75 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 3 ? ? 54.61 160.09 2 1 ASP A 7 ? ? 64.64 -91.52 3 1 SER A 8 ? ? -152.36 30.74 4 1 SER A 13 ? ? -43.26 159.87 5 1 VAL A 14 ? ? -50.47 173.91 6 1 TRP A 18 ? ? -170.20 129.31 7 1 LEU A 32 ? ? -143.18 24.08 8 1 GLU A 40 ? ? -36.33 158.20 9 1 THR A 41 ? ? -64.89 62.20 10 1 VAL A 43 ? ? -47.65 -178.35 11 1 GLN A 45 ? ? -63.11 68.63 12 1 TYR A 47 ? ? -175.70 149.45 13 1 ASN A 50 ? ? -89.68 32.82 14 1 SER A 51 ? ? -142.27 12.11 15 1 GLU A 54 ? ? -61.96 -174.39 16 1 VAL A 57 ? ? -154.50 66.99 17 1 ASN A 63 ? ? 76.28 -11.32 18 1 THR A 84 ? ? -95.53 30.15 19 1 THR A 85 ? ? -172.88 131.93 20 1 TYR A 88 ? ? -45.09 -74.33 21 1 ASP A 99 ? ? 33.00 39.34 22 1 HIS A 100 ? ? 33.54 43.96 23 1 THR A 101 ? ? 28.64 47.93 24 1 VAL A 102 ? ? -38.88 149.22 25 1 ASN A 110 ? ? -148.24 16.52 26 1 ASN A 112 ? ? 44.31 89.32 27 1 LEU A 115 ? ? -64.89 84.31 28 1 ASN A 124 ? ? 48.48 24.99 29 1 ASN A 126 ? ? -34.88 142.67 30 1 ASP A 129 ? ? 166.95 139.53 31 1 CYS A 130 ? ? -49.14 86.41 32 1 SER A 132 ? ? -109.75 53.83 33 1 ASN A 138 ? ? -41.07 91.16 34 1 MET A 139 ? ? -164.46 54.16 35 1 LYS A 140 ? ? -36.36 142.60 36 1 PRO A 158 ? ? -53.73 -176.27 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 2-acetamido-2-deoxy-beta-D-glucopyranose _pdbx_entity_nonpoly.comp_id NAG #