data_1E8P # _entry.id 1E8P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1E8P pdb_00001e8p 10.2210/pdb1e8p/pdb PDBE EBI-5401 ? ? WWPDB D_1290005401 ? ? BMRB 3322 ? 10.13018/BMR3322 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-09-07 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-06-20 5 'Structure model' 1 4 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Source and taxonomy' 6 4 'Structure model' 'Structure summary' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' Other 10 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' citation_author 3 4 'Structure model' entity 4 4 'Structure model' entity_src_gen 5 4 'Structure model' struct_ref 6 4 'Structure model' struct_ref_seq 7 4 'Structure model' struct_ref_seq_dif 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' database_2 11 5 'Structure model' pdbx_database_status 12 5 'Structure model' pdbx_entry_details 13 5 'Structure model' pdbx_modification_feature 14 5 'Structure model' pdbx_nmr_software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_abbrev' 2 4 'Structure model' '_citation.page_last' 3 4 'Structure model' '_citation.pdbx_database_id_DOI' 4 4 'Structure model' '_citation.title' 5 4 'Structure model' '_citation_author.name' 6 4 'Structure model' '_entity.pdbx_description' 7 4 'Structure model' '_entity_src_gen.pdbx_beg_seq_num' 8 4 'Structure model' '_entity_src_gen.pdbx_end_seq_num' 9 4 'Structure model' '_entity_src_gen.pdbx_gene_src_gene' 10 4 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' 11 4 'Structure model' '_entity_src_gen.pdbx_seq_type' 12 4 'Structure model' '_struct_ref.db_code' 13 4 'Structure model' '_struct_ref.pdbx_align_begin' 14 4 'Structure model' '_struct_ref.pdbx_db_accession' 15 4 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 16 4 'Structure model' '_struct_ref_seq.pdbx_db_accession' 17 4 'Structure model' '_struct_ref_seq_dif.pdbx_seq_db_accession_code' 18 5 'Structure model' '_database_2.pdbx_DOI' 19 5 'Structure model' '_database_2.pdbx_database_accession' 20 5 'Structure model' '_pdbx_database_status.status_code_mr' 21 5 'Structure model' '_pdbx_entry_details.has_protein_modification' 22 5 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1E8P _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2000-09-28 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1E8Q unspecified 'CHARACTERISATION OF THE CELLULOSE DOCKING DOMAIN FROM PIROMYCES EQUI' BMRB 3322 unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Raghothama, S.' 1 ? 'Eberhardt, R.Y.' 2 ? 'White, P.' 3 ? 'Hazlewood, G.P.' 4 ? 'Gilbert, H.J.' 5 ? 'Simpson, P.J.' 6 ? 'Williamson, M.P.' 7 ? # _citation.id primary _citation.title 'Characterization of a cellulosome dockerin domain from the anaerobic fungus Piromyces equi.' _citation.journal_abbrev 'Nat. Struct. Biol.' _citation.journal_volume 8 _citation.page_first 775 _citation.page_last 778 _citation.year 2001 _citation.journal_id_ASTM NSBIEW _citation.country US _citation.journal_id_ISSN 1072-8368 _citation.journal_id_CSD 2024 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11524680 _citation.pdbx_database_id_DOI 10.1038/nsb0901-775 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Raghothama, S.' 1 ? primary 'Eberhardt, R.Y.' 2 ? primary 'Simpson, P.' 3 ? primary 'Wigelsworth, D.' 4 ? primary 'White, P.' 5 ? primary 'Hazlewood, G.P.' 6 ? primary 'Nagy, T.' 7 ? primary 'Gilbert, H.J.' 8 ? primary 'Williamson, M.P.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Endoglucanase 45A' _entity.formula_weight 5044.316 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'CELLULOSE DOCKING DOMAIN' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name DOCKERIN # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ASCWAQSQGYNCCNNPSSTKVEYTDASGQWGVQNGQWCGIDYSYGQ _entity_poly.pdbx_seq_one_letter_code_can ASCWAQSQGYNCCNNPSSTKVEYTDASGQWGVQNGQWCGIDYSYGQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 SER n 1 3 CYS n 1 4 TRP n 1 5 ALA n 1 6 GLN n 1 7 SER n 1 8 GLN n 1 9 GLY n 1 10 TYR n 1 11 ASN n 1 12 CYS n 1 13 CYS n 1 14 ASN n 1 15 ASN n 1 16 PRO n 1 17 SER n 1 18 SER n 1 19 THR n 1 20 LYS n 1 21 VAL n 1 22 GLU n 1 23 TYR n 1 24 THR n 1 25 ASP n 1 26 ALA n 1 27 SER n 1 28 GLY n 1 29 GLN n 1 30 TRP n 1 31 GLY n 1 32 VAL n 1 33 GLN n 1 34 ASN n 1 35 GLY n 1 36 GLN n 1 37 TRP n 1 38 CYS n 1 39 GLY n 1 40 ILE n 1 41 ASP n 1 42 TYR n 1 43 SER n 1 44 TYR n 1 45 GLY n 1 46 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 46 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene cel45A _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Piromyces equi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 99929 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PGEX _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 GLN 46 46 46 GLN GLN A . n # _cell.entry_id 1E8P _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1E8P _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1E8P _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1E8P _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1E8P _struct.title 'Characterisation of the cellulose docking domain from Piromyces equi' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'MINIMIZED AVERAGE' # _struct_keywords.entry_id 1E8P _struct_keywords.pdbx_keywords 'CELLULOSE DOCKING DOMAIN' _struct_keywords.text 'CELLULOSE DOCKING DOMAIN, CELLULASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9P868_PIREQ _struct_ref.pdbx_db_accession Q9P868 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AACWAQSQGYNCCNNPSSTKVEYTDASGQWGVQNGQWCGIDYSYGQ _struct_ref.pdbx_align_begin 20 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1E8P _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 46 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9P868 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 65 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 46 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1E8P _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 2 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9P868 _struct_ref_seq_dif.db_mon_id ALA _struct_ref_seq_dif.pdbx_seq_db_seq_num 21 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 2 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 3 ? GLN A 8 ? CYS A 3 GLN A 8 5 ? 6 HELX_P HELX_P2 2 ASN A 15 ? THR A 19 ? ASN A 15 THR A 19 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 12 SG ? ? A CYS 3 A CYS 12 1_555 ? ? ? ? ? ? ? 2.017 ? ? disulf2 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 13 A CYS 38 1_555 ? ? ? ? ? ? ? 2.018 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 3 ? CYS A 12 ? CYS A 3 ? 1_555 CYS A 12 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 13 ? CYS A 38 ? CYS A 13 ? 1_555 CYS A 38 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 36 ? ILE A 40 ? GLN A 36 ILE A 40 A 2 GLY A 28 ? GLN A 33 ? GLY A 28 GLN A 33 A 3 VAL A 21 ? ASP A 25 ? VAL A 21 ASP A 25 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 36 ? O GLN A 36 N GLN A 33 ? N GLN A 33 A 2 3 O GLY A 28 ? O GLY A 28 N ASP A 25 ? N ASP A 25 # _pdbx_entry_details.entry_id 1E8P _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'SER 2, NMR SAMPLE HAS SER AT THIS POSITION' _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -154.93 25.10 2 1 CYS A 3 ? ? -43.68 103.67 3 1 ASN A 11 ? ? -75.06 -150.52 4 1 ASN A 15 ? ? 57.70 93.15 5 1 SER A 18 ? ? -151.20 16.99 6 1 THR A 24 ? ? -170.65 110.40 # _pdbx_nmr_ensemble.entry_id 1E8P _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'MINIMISED AVERAGE STRUCTURE' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '50 MM SODIUM PHOSPHATE' _pdbx_nmr_sample_details.solvent_system ? _pdbx_nmr_sample_details.label ? _pdbx_nmr_sample_details.type ? _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '3D - HSQC/NOESY' 1 2 1 HNHA 1 3 1 HNHB 1 4 1 '2D - HSQC' 1 5 1 '15N DECOUPLED TOCSY' 1 6 1 NOESY 1 7 1 DQF-COSY 1 8 1 E.COSY 1 # _pdbx_nmr_details.entry_id 1E8P _pdbx_nmr_details.text 'MINIMISED AVERAGE STRUCTURE. THE STRUCTURE WAS DETERMINED USING STANDARD 2D & 3D NMR TECHNIQUES.' # _pdbx_nmr_refine.entry_id 1E8P _pdbx_nmr_refine.method 'DISTANCE GEOMETRY, SIMULATED ANNEALING' _pdbx_nmr_refine.details 'YASAP PROTOCOL' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' Felix ? ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 ILE N N N N 110 ILE CA C N S 111 ILE C C N N 112 ILE O O N N 113 ILE CB C N S 114 ILE CG1 C N N 115 ILE CG2 C N N 116 ILE CD1 C N N 117 ILE OXT O N N 118 ILE H H N N 119 ILE H2 H N N 120 ILE HA H N N 121 ILE HB H N N 122 ILE HG12 H N N 123 ILE HG13 H N N 124 ILE HG21 H N N 125 ILE HG22 H N N 126 ILE HG23 H N N 127 ILE HD11 H N N 128 ILE HD12 H N N 129 ILE HD13 H N N 130 ILE HXT H N N 131 LYS N N N N 132 LYS CA C N S 133 LYS C C N N 134 LYS O O N N 135 LYS CB C N N 136 LYS CG C N N 137 LYS CD C N N 138 LYS CE C N N 139 LYS NZ N N N 140 LYS OXT O N N 141 LYS H H N N 142 LYS H2 H N N 143 LYS HA H N N 144 LYS HB2 H N N 145 LYS HB3 H N N 146 LYS HG2 H N N 147 LYS HG3 H N N 148 LYS HD2 H N N 149 LYS HD3 H N N 150 LYS HE2 H N N 151 LYS HE3 H N N 152 LYS HZ1 H N N 153 LYS HZ2 H N N 154 LYS HZ3 H N N 155 LYS HXT H N N 156 PRO N N N N 157 PRO CA C N S 158 PRO C C N N 159 PRO O O N N 160 PRO CB C N N 161 PRO CG C N N 162 PRO CD C N N 163 PRO OXT O N N 164 PRO H H N N 165 PRO HA H N N 166 PRO HB2 H N N 167 PRO HB3 H N N 168 PRO HG2 H N N 169 PRO HG3 H N N 170 PRO HD2 H N N 171 PRO HD3 H N N 172 PRO HXT H N N 173 SER N N N N 174 SER CA C N S 175 SER C C N N 176 SER O O N N 177 SER CB C N N 178 SER OG O N N 179 SER OXT O N N 180 SER H H N N 181 SER H2 H N N 182 SER HA H N N 183 SER HB2 H N N 184 SER HB3 H N N 185 SER HG H N N 186 SER HXT H N N 187 THR N N N N 188 THR CA C N S 189 THR C C N N 190 THR O O N N 191 THR CB C N R 192 THR OG1 O N N 193 THR CG2 C N N 194 THR OXT O N N 195 THR H H N N 196 THR H2 H N N 197 THR HA H N N 198 THR HB H N N 199 THR HG1 H N N 200 THR HG21 H N N 201 THR HG22 H N N 202 THR HG23 H N N 203 THR HXT H N N 204 TRP N N N N 205 TRP CA C N S 206 TRP C C N N 207 TRP O O N N 208 TRP CB C N N 209 TRP CG C Y N 210 TRP CD1 C Y N 211 TRP CD2 C Y N 212 TRP NE1 N Y N 213 TRP CE2 C Y N 214 TRP CE3 C Y N 215 TRP CZ2 C Y N 216 TRP CZ3 C Y N 217 TRP CH2 C Y N 218 TRP OXT O N N 219 TRP H H N N 220 TRP H2 H N N 221 TRP HA H N N 222 TRP HB2 H N N 223 TRP HB3 H N N 224 TRP HD1 H N N 225 TRP HE1 H N N 226 TRP HE3 H N N 227 TRP HZ2 H N N 228 TRP HZ3 H N N 229 TRP HH2 H N N 230 TRP HXT H N N 231 TYR N N N N 232 TYR CA C N S 233 TYR C C N N 234 TYR O O N N 235 TYR CB C N N 236 TYR CG C Y N 237 TYR CD1 C Y N 238 TYR CD2 C Y N 239 TYR CE1 C Y N 240 TYR CE2 C Y N 241 TYR CZ C Y N 242 TYR OH O N N 243 TYR OXT O N N 244 TYR H H N N 245 TYR H2 H N N 246 TYR HA H N N 247 TYR HB2 H N N 248 TYR HB3 H N N 249 TYR HD1 H N N 250 TYR HD2 H N N 251 TYR HE1 H N N 252 TYR HE2 H N N 253 TYR HH H N N 254 TYR HXT H N N 255 VAL N N N N 256 VAL CA C N S 257 VAL C C N N 258 VAL O O N N 259 VAL CB C N N 260 VAL CG1 C N N 261 VAL CG2 C N N 262 VAL OXT O N N 263 VAL H H N N 264 VAL H2 H N N 265 VAL HA H N N 266 VAL HB H N N 267 VAL HG11 H N N 268 VAL HG12 H N N 269 VAL HG13 H N N 270 VAL HG21 H N N 271 VAL HG22 H N N 272 VAL HG23 H N N 273 VAL HXT H N N 274 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 ILE N CA sing N N 103 ILE N H sing N N 104 ILE N H2 sing N N 105 ILE CA C sing N N 106 ILE CA CB sing N N 107 ILE CA HA sing N N 108 ILE C O doub N N 109 ILE C OXT sing N N 110 ILE CB CG1 sing N N 111 ILE CB CG2 sing N N 112 ILE CB HB sing N N 113 ILE CG1 CD1 sing N N 114 ILE CG1 HG12 sing N N 115 ILE CG1 HG13 sing N N 116 ILE CG2 HG21 sing N N 117 ILE CG2 HG22 sing N N 118 ILE CG2 HG23 sing N N 119 ILE CD1 HD11 sing N N 120 ILE CD1 HD12 sing N N 121 ILE CD1 HD13 sing N N 122 ILE OXT HXT sing N N 123 LYS N CA sing N N 124 LYS N H sing N N 125 LYS N H2 sing N N 126 LYS CA C sing N N 127 LYS CA CB sing N N 128 LYS CA HA sing N N 129 LYS C O doub N N 130 LYS C OXT sing N N 131 LYS CB CG sing N N 132 LYS CB HB2 sing N N 133 LYS CB HB3 sing N N 134 LYS CG CD sing N N 135 LYS CG HG2 sing N N 136 LYS CG HG3 sing N N 137 LYS CD CE sing N N 138 LYS CD HD2 sing N N 139 LYS CD HD3 sing N N 140 LYS CE NZ sing N N 141 LYS CE HE2 sing N N 142 LYS CE HE3 sing N N 143 LYS NZ HZ1 sing N N 144 LYS NZ HZ2 sing N N 145 LYS NZ HZ3 sing N N 146 LYS OXT HXT sing N N 147 PRO N CA sing N N 148 PRO N CD sing N N 149 PRO N H sing N N 150 PRO CA C sing N N 151 PRO CA CB sing N N 152 PRO CA HA sing N N 153 PRO C O doub N N 154 PRO C OXT sing N N 155 PRO CB CG sing N N 156 PRO CB HB2 sing N N 157 PRO CB HB3 sing N N 158 PRO CG CD sing N N 159 PRO CG HG2 sing N N 160 PRO CG HG3 sing N N 161 PRO CD HD2 sing N N 162 PRO CD HD3 sing N N 163 PRO OXT HXT sing N N 164 SER N CA sing N N 165 SER N H sing N N 166 SER N H2 sing N N 167 SER CA C sing N N 168 SER CA CB sing N N 169 SER CA HA sing N N 170 SER C O doub N N 171 SER C OXT sing N N 172 SER CB OG sing N N 173 SER CB HB2 sing N N 174 SER CB HB3 sing N N 175 SER OG HG sing N N 176 SER OXT HXT sing N N 177 THR N CA sing N N 178 THR N H sing N N 179 THR N H2 sing N N 180 THR CA C sing N N 181 THR CA CB sing N N 182 THR CA HA sing N N 183 THR C O doub N N 184 THR C OXT sing N N 185 THR CB OG1 sing N N 186 THR CB CG2 sing N N 187 THR CB HB sing N N 188 THR OG1 HG1 sing N N 189 THR CG2 HG21 sing N N 190 THR CG2 HG22 sing N N 191 THR CG2 HG23 sing N N 192 THR OXT HXT sing N N 193 TRP N CA sing N N 194 TRP N H sing N N 195 TRP N H2 sing N N 196 TRP CA C sing N N 197 TRP CA CB sing N N 198 TRP CA HA sing N N 199 TRP C O doub N N 200 TRP C OXT sing N N 201 TRP CB CG sing N N 202 TRP CB HB2 sing N N 203 TRP CB HB3 sing N N 204 TRP CG CD1 doub Y N 205 TRP CG CD2 sing Y N 206 TRP CD1 NE1 sing Y N 207 TRP CD1 HD1 sing N N 208 TRP CD2 CE2 doub Y N 209 TRP CD2 CE3 sing Y N 210 TRP NE1 CE2 sing Y N 211 TRP NE1 HE1 sing N N 212 TRP CE2 CZ2 sing Y N 213 TRP CE3 CZ3 doub Y N 214 TRP CE3 HE3 sing N N 215 TRP CZ2 CH2 doub Y N 216 TRP CZ2 HZ2 sing N N 217 TRP CZ3 CH2 sing Y N 218 TRP CZ3 HZ3 sing N N 219 TRP CH2 HH2 sing N N 220 TRP OXT HXT sing N N 221 TYR N CA sing N N 222 TYR N H sing N N 223 TYR N H2 sing N N 224 TYR CA C sing N N 225 TYR CA CB sing N N 226 TYR CA HA sing N N 227 TYR C O doub N N 228 TYR C OXT sing N N 229 TYR CB CG sing N N 230 TYR CB HB2 sing N N 231 TYR CB HB3 sing N N 232 TYR CG CD1 doub Y N 233 TYR CG CD2 sing Y N 234 TYR CD1 CE1 sing Y N 235 TYR CD1 HD1 sing N N 236 TYR CD2 CE2 doub Y N 237 TYR CD2 HD2 sing N N 238 TYR CE1 CZ doub Y N 239 TYR CE1 HE1 sing N N 240 TYR CE2 CZ sing Y N 241 TYR CE2 HE2 sing N N 242 TYR CZ OH sing N N 243 TYR OH HH sing N N 244 TYR OXT HXT sing N N 245 VAL N CA sing N N 246 VAL N H sing N N 247 VAL N H2 sing N N 248 VAL CA C sing N N 249 VAL CA CB sing N N 250 VAL CA HA sing N N 251 VAL C O doub N N 252 VAL C OXT sing N N 253 VAL CB CG1 sing N N 254 VAL CB CG2 sing N N 255 VAL CB HB sing N N 256 VAL CG1 HG11 sing N N 257 VAL CG1 HG12 sing N N 258 VAL CG1 HG13 sing N N 259 VAL CG2 HG21 sing N N 260 VAL CG2 HG22 sing N N 261 VAL CG2 HG23 sing N N 262 VAL OXT HXT sing N N 263 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DRX Bruker 500 ? 2 DRX Bruker 600 ? # _atom_sites.entry_id 1E8P _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_