data_1E8P
# 
_entry.id   1E8P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1E8P         pdb_00001e8p 10.2210/pdb1e8p/pdb 
PDBE  EBI-5401     ?            ?                   
WWPDB D_1290005401 ?            ?                   
BMRB  3322         ?            10.13018/BMR3322    
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-09-07 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-06-20 
5 'Structure model' 1 4 2024-11-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Version format compliance' 
3  4 'Structure model' 'Data collection'           
4  4 'Structure model' 'Database references'       
5  4 'Structure model' 'Source and taxonomy'       
6  4 'Structure model' 'Structure summary'         
7  5 'Structure model' 'Data collection'           
8  5 'Structure model' 'Database references'       
9  5 'Structure model' Other                       
10 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' citation                  
2  4 'Structure model' citation_author           
3  4 'Structure model' entity                    
4  4 'Structure model' entity_src_gen            
5  4 'Structure model' struct_ref                
6  4 'Structure model' struct_ref_seq            
7  4 'Structure model' struct_ref_seq_dif        
8  5 'Structure model' chem_comp_atom            
9  5 'Structure model' chem_comp_bond            
10 5 'Structure model' database_2                
11 5 'Structure model' pdbx_database_status      
12 5 'Structure model' pdbx_entry_details        
13 5 'Structure model' pdbx_modification_feature 
14 5 'Structure model' pdbx_nmr_software         
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_citation.journal_abbrev'                       
2  4 'Structure model' '_citation.page_last'                            
3  4 'Structure model' '_citation.pdbx_database_id_DOI'                 
4  4 'Structure model' '_citation.title'                                
5  4 'Structure model' '_citation_author.name'                          
6  4 'Structure model' '_entity.pdbx_description'                       
7  4 'Structure model' '_entity_src_gen.pdbx_beg_seq_num'               
8  4 'Structure model' '_entity_src_gen.pdbx_end_seq_num'               
9  4 'Structure model' '_entity_src_gen.pdbx_gene_src_gene'             
10 4 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name'  
11 4 'Structure model' '_entity_src_gen.pdbx_seq_type'                  
12 4 'Structure model' '_struct_ref.db_code'                            
13 4 'Structure model' '_struct_ref.pdbx_align_begin'                   
14 4 'Structure model' '_struct_ref.pdbx_db_accession'                  
15 4 'Structure model' '_struct_ref.pdbx_seq_one_letter_code'           
16 4 'Structure model' '_struct_ref_seq.pdbx_db_accession'              
17 4 'Structure model' '_struct_ref_seq_dif.pdbx_seq_db_accession_code' 
18 5 'Structure model' '_database_2.pdbx_DOI'                           
19 5 'Structure model' '_database_2.pdbx_database_accession'            
20 5 'Structure model' '_pdbx_database_status.status_code_mr'           
21 5 'Structure model' '_pdbx_entry_details.has_protein_modification'   
22 5 'Structure model' '_pdbx_nmr_software.name'                        
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1E8P 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2000-09-28 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB  1E8Q unspecified 'CHARACTERISATION OF THE CELLULOSE DOCKING DOMAIN FROM PIROMYCES EQUI' 
BMRB 3322 unspecified .                                                                      
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Raghothama, S.'   1 ? 
'Eberhardt, R.Y.'  2 ? 
'White, P.'        3 ? 
'Hazlewood, G.P.'  4 ? 
'Gilbert, H.J.'    5 ? 
'Simpson, P.J.'    6 ? 
'Williamson, M.P.' 7 ? 
# 
_citation.id                        primary 
_citation.title                     'Characterization of a cellulosome dockerin domain from the anaerobic fungus Piromyces equi.' 
_citation.journal_abbrev            'Nat. Struct. Biol.' 
_citation.journal_volume            8 
_citation.page_first                775 
_citation.page_last                 778 
_citation.year                      2001 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11524680 
_citation.pdbx_database_id_DOI      10.1038/nsb0901-775 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Raghothama, S.'   1 ? 
primary 'Eberhardt, R.Y.'  2 ? 
primary 'Simpson, P.'      3 ? 
primary 'Wigelsworth, D.'  4 ? 
primary 'White, P.'        5 ? 
primary 'Hazlewood, G.P.'  6 ? 
primary 'Nagy, T.'         7 ? 
primary 'Gilbert, H.J.'    8 ? 
primary 'Williamson, M.P.' 9 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Endoglucanase 45A' 
_entity.formula_weight             5044.316 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'CELLULOSE DOCKING DOMAIN' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        DOCKERIN 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       ASCWAQSQGYNCCNNPSSTKVEYTDASGQWGVQNGQWCGIDYSYGQ 
_entity_poly.pdbx_seq_one_letter_code_can   ASCWAQSQGYNCCNNPSSTKVEYTDASGQWGVQNGQWCGIDYSYGQ 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  SER n 
1 3  CYS n 
1 4  TRP n 
1 5  ALA n 
1 6  GLN n 
1 7  SER n 
1 8  GLN n 
1 9  GLY n 
1 10 TYR n 
1 11 ASN n 
1 12 CYS n 
1 13 CYS n 
1 14 ASN n 
1 15 ASN n 
1 16 PRO n 
1 17 SER n 
1 18 SER n 
1 19 THR n 
1 20 LYS n 
1 21 VAL n 
1 22 GLU n 
1 23 TYR n 
1 24 THR n 
1 25 ASP n 
1 26 ALA n 
1 27 SER n 
1 28 GLY n 
1 29 GLN n 
1 30 TRP n 
1 31 GLY n 
1 32 VAL n 
1 33 GLN n 
1 34 ASN n 
1 35 GLY n 
1 36 GLN n 
1 37 TRP n 
1 38 CYS n 
1 39 GLY n 
1 40 ILE n 
1 41 ASP n 
1 42 TYR n 
1 43 SER n 
1 44 TYR n 
1 45 GLY n 
1 46 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   46 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 cel45A 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Piromyces equi' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     99929 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGEX 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  1  1  ALA ALA A . n 
A 1 2  SER 2  2  2  SER SER A . n 
A 1 3  CYS 3  3  3  CYS CYS A . n 
A 1 4  TRP 4  4  4  TRP TRP A . n 
A 1 5  ALA 5  5  5  ALA ALA A . n 
A 1 6  GLN 6  6  6  GLN GLN A . n 
A 1 7  SER 7  7  7  SER SER A . n 
A 1 8  GLN 8  8  8  GLN GLN A . n 
A 1 9  GLY 9  9  9  GLY GLY A . n 
A 1 10 TYR 10 10 10 TYR TYR A . n 
A 1 11 ASN 11 11 11 ASN ASN A . n 
A 1 12 CYS 12 12 12 CYS CYS A . n 
A 1 13 CYS 13 13 13 CYS CYS A . n 
A 1 14 ASN 14 14 14 ASN ASN A . n 
A 1 15 ASN 15 15 15 ASN ASN A . n 
A 1 16 PRO 16 16 16 PRO PRO A . n 
A 1 17 SER 17 17 17 SER SER A . n 
A 1 18 SER 18 18 18 SER SER A . n 
A 1 19 THR 19 19 19 THR THR A . n 
A 1 20 LYS 20 20 20 LYS LYS A . n 
A 1 21 VAL 21 21 21 VAL VAL A . n 
A 1 22 GLU 22 22 22 GLU GLU A . n 
A 1 23 TYR 23 23 23 TYR TYR A . n 
A 1 24 THR 24 24 24 THR THR A . n 
A 1 25 ASP 25 25 25 ASP ASP A . n 
A 1 26 ALA 26 26 26 ALA ALA A . n 
A 1 27 SER 27 27 27 SER SER A . n 
A 1 28 GLY 28 28 28 GLY GLY A . n 
A 1 29 GLN 29 29 29 GLN GLN A . n 
A 1 30 TRP 30 30 30 TRP TRP A . n 
A 1 31 GLY 31 31 31 GLY GLY A . n 
A 1 32 VAL 32 32 32 VAL VAL A . n 
A 1 33 GLN 33 33 33 GLN GLN A . n 
A 1 34 ASN 34 34 34 ASN ASN A . n 
A 1 35 GLY 35 35 35 GLY GLY A . n 
A 1 36 GLN 36 36 36 GLN GLN A . n 
A 1 37 TRP 37 37 37 TRP TRP A . n 
A 1 38 CYS 38 38 38 CYS CYS A . n 
A 1 39 GLY 39 39 39 GLY GLY A . n 
A 1 40 ILE 40 40 40 ILE ILE A . n 
A 1 41 ASP 41 41 41 ASP ASP A . n 
A 1 42 TYR 42 42 42 TYR TYR A . n 
A 1 43 SER 43 43 43 SER SER A . n 
A 1 44 TYR 44 44 44 TYR TYR A . n 
A 1 45 GLY 45 45 45 GLY GLY A . n 
A 1 46 GLN 46 46 46 GLN GLN A . n 
# 
_cell.entry_id           1E8P 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1E8P 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_exptl.entry_id          1E8P 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_database_PDB_matrix.entry_id          1E8P 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1E8P 
_struct.title                     'Characterisation of the cellulose docking domain from Piromyces equi' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   'MINIMIZED AVERAGE' 
# 
_struct_keywords.entry_id        1E8P 
_struct_keywords.pdbx_keywords   'CELLULOSE DOCKING DOMAIN' 
_struct_keywords.text            'CELLULOSE DOCKING DOMAIN, CELLULASE' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q9P868_PIREQ 
_struct_ref.pdbx_db_accession          Q9P868 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   AACWAQSQGYNCCNNPSSTKVEYTDASGQWGVQNGQWCGIDYSYGQ 
_struct_ref.pdbx_align_begin           20 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1E8P 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 46 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9P868 
_struct_ref_seq.db_align_beg                  20 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  65 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       46 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1E8P 
_struct_ref_seq_dif.mon_id                       SER 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      2 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q9P868 
_struct_ref_seq_dif.db_mon_id                    ALA 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          21 
_struct_ref_seq_dif.details                      conflict 
_struct_ref_seq_dif.pdbx_auth_seq_num            2 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 CYS A 3  ? GLN A 8  ? CYS A 3  GLN A 8  5 ? 6 
HELX_P HELX_P2 2 ASN A 15 ? THR A 19 ? ASN A 15 THR A 19 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 3  SG ? ? ? 1_555 A CYS 12 SG ? ? A CYS 3  A CYS 12 1_555 ? ? ? ? ? ? ? 2.017 ? ? 
disulf2 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 13 A CYS 38 1_555 ? ? ? ? ? ? ? 2.018 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 CYS A 3  ? CYS A 12 ? CYS A 3  ? 1_555 CYS A 12 ? 1_555 SG SG . . . None 'Disulfide bridge' 
2 CYS A 13 ? CYS A 38 ? CYS A 13 ? 1_555 CYS A 38 ? 1_555 SG SG . . . None 'Disulfide bridge' 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 36 ? ILE A 40 ? GLN A 36 ILE A 40 
A 2 GLY A 28 ? GLN A 33 ? GLY A 28 GLN A 33 
A 3 VAL A 21 ? ASP A 25 ? VAL A 21 ASP A 25 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLN A 36 ? O GLN A 36 N GLN A 33 ? N GLN A 33 
A 2 3 O GLY A 28 ? O GLY A 28 N ASP A 25 ? N ASP A 25 
# 
_pdbx_entry_details.entry_id                   1E8P 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           'SER 2, NMR SAMPLE HAS SER AT THIS POSITION' 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 2  ? ? -154.93 25.10   
2 1 CYS A 3  ? ? -43.68  103.67  
3 1 ASN A 11 ? ? -75.06  -150.52 
4 1 ASN A 15 ? ? 57.70   93.15   
5 1 SER A 18 ? ? -151.20 16.99   
6 1 THR A 24 ? ? -170.65 110.40  
# 
_pdbx_nmr_ensemble.entry_id                             1E8P 
_pdbx_nmr_ensemble.conformers_calculated_total_number   50 
_pdbx_nmr_ensemble.conformers_submitted_total_number    1 
_pdbx_nmr_ensemble.conformer_selection_criteria         'MINIMISED AVERAGE STRUCTURE' 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '50 MM SODIUM PHOSPHATE' 
_pdbx_nmr_sample_details.solvent_system   ? 
_pdbx_nmr_sample_details.label            ? 
_pdbx_nmr_sample_details.type             ? 
_pdbx_nmr_sample_details.details          ? 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            298 
_pdbx_nmr_exptl_sample_conditions.pressure_units         ? 
_pdbx_nmr_exptl_sample_conditions.pressure               AMBIENT 
_pdbx_nmr_exptl_sample_conditions.pH                     6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
_pdbx_nmr_exptl_sample_conditions.label                  ? 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 '3D - HSQC/NOESY'     1 
2 1 HNHA                  1 
3 1 HNHB                  1 
4 1 '2D - HSQC'           1 
5 1 '15N DECOUPLED TOCSY' 1 
6 1 NOESY                 1 
7 1 DQF-COSY              1 
8 1 E.COSY                1 
# 
_pdbx_nmr_details.entry_id   1E8P 
_pdbx_nmr_details.text       'MINIMISED AVERAGE STRUCTURE. THE STRUCTURE WAS DETERMINED USING STANDARD 2D & 3D NMR TECHNIQUES.' 
# 
_pdbx_nmr_refine.entry_id           1E8P 
_pdbx_nmr_refine.method             'DISTANCE GEOMETRY, SIMULATED ANNEALING' 
_pdbx_nmr_refine.details            'YASAP PROTOCOL' 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           X-PLOR 3.1 BRUNGER 1 
'structure solution' Felix  ?   ?       2 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ASN N    N N N 14  
ASN CA   C N S 15  
ASN C    C N N 16  
ASN O    O N N 17  
ASN CB   C N N 18  
ASN CG   C N N 19  
ASN OD1  O N N 20  
ASN ND2  N N N 21  
ASN OXT  O N N 22  
ASN H    H N N 23  
ASN H2   H N N 24  
ASN HA   H N N 25  
ASN HB2  H N N 26  
ASN HB3  H N N 27  
ASN HD21 H N N 28  
ASN HD22 H N N 29  
ASN HXT  H N N 30  
ASP N    N N N 31  
ASP CA   C N S 32  
ASP C    C N N 33  
ASP O    O N N 34  
ASP CB   C N N 35  
ASP CG   C N N 36  
ASP OD1  O N N 37  
ASP OD2  O N N 38  
ASP OXT  O N N 39  
ASP H    H N N 40  
ASP H2   H N N 41  
ASP HA   H N N 42  
ASP HB2  H N N 43  
ASP HB3  H N N 44  
ASP HD2  H N N 45  
ASP HXT  H N N 46  
CYS N    N N N 47  
CYS CA   C N R 48  
CYS C    C N N 49  
CYS O    O N N 50  
CYS CB   C N N 51  
CYS SG   S N N 52  
CYS OXT  O N N 53  
CYS H    H N N 54  
CYS H2   H N N 55  
CYS HA   H N N 56  
CYS HB2  H N N 57  
CYS HB3  H N N 58  
CYS HG   H N N 59  
CYS HXT  H N N 60  
GLN N    N N N 61  
GLN CA   C N S 62  
GLN C    C N N 63  
GLN O    O N N 64  
GLN CB   C N N 65  
GLN CG   C N N 66  
GLN CD   C N N 67  
GLN OE1  O N N 68  
GLN NE2  N N N 69  
GLN OXT  O N N 70  
GLN H    H N N 71  
GLN H2   H N N 72  
GLN HA   H N N 73  
GLN HB2  H N N 74  
GLN HB3  H N N 75  
GLN HG2  H N N 76  
GLN HG3  H N N 77  
GLN HE21 H N N 78  
GLN HE22 H N N 79  
GLN HXT  H N N 80  
GLU N    N N N 81  
GLU CA   C N S 82  
GLU C    C N N 83  
GLU O    O N N 84  
GLU CB   C N N 85  
GLU CG   C N N 86  
GLU CD   C N N 87  
GLU OE1  O N N 88  
GLU OE2  O N N 89  
GLU OXT  O N N 90  
GLU H    H N N 91  
GLU H2   H N N 92  
GLU HA   H N N 93  
GLU HB2  H N N 94  
GLU HB3  H N N 95  
GLU HG2  H N N 96  
GLU HG3  H N N 97  
GLU HE2  H N N 98  
GLU HXT  H N N 99  
GLY N    N N N 100 
GLY CA   C N N 101 
GLY C    C N N 102 
GLY O    O N N 103 
GLY OXT  O N N 104 
GLY H    H N N 105 
GLY H2   H N N 106 
GLY HA2  H N N 107 
GLY HA3  H N N 108 
GLY HXT  H N N 109 
ILE N    N N N 110 
ILE CA   C N S 111 
ILE C    C N N 112 
ILE O    O N N 113 
ILE CB   C N S 114 
ILE CG1  C N N 115 
ILE CG2  C N N 116 
ILE CD1  C N N 117 
ILE OXT  O N N 118 
ILE H    H N N 119 
ILE H2   H N N 120 
ILE HA   H N N 121 
ILE HB   H N N 122 
ILE HG12 H N N 123 
ILE HG13 H N N 124 
ILE HG21 H N N 125 
ILE HG22 H N N 126 
ILE HG23 H N N 127 
ILE HD11 H N N 128 
ILE HD12 H N N 129 
ILE HD13 H N N 130 
ILE HXT  H N N 131 
LYS N    N N N 132 
LYS CA   C N S 133 
LYS C    C N N 134 
LYS O    O N N 135 
LYS CB   C N N 136 
LYS CG   C N N 137 
LYS CD   C N N 138 
LYS CE   C N N 139 
LYS NZ   N N N 140 
LYS OXT  O N N 141 
LYS H    H N N 142 
LYS H2   H N N 143 
LYS HA   H N N 144 
LYS HB2  H N N 145 
LYS HB3  H N N 146 
LYS HG2  H N N 147 
LYS HG3  H N N 148 
LYS HD2  H N N 149 
LYS HD3  H N N 150 
LYS HE2  H N N 151 
LYS HE3  H N N 152 
LYS HZ1  H N N 153 
LYS HZ2  H N N 154 
LYS HZ3  H N N 155 
LYS HXT  H N N 156 
PRO N    N N N 157 
PRO CA   C N S 158 
PRO C    C N N 159 
PRO O    O N N 160 
PRO CB   C N N 161 
PRO CG   C N N 162 
PRO CD   C N N 163 
PRO OXT  O N N 164 
PRO H    H N N 165 
PRO HA   H N N 166 
PRO HB2  H N N 167 
PRO HB3  H N N 168 
PRO HG2  H N N 169 
PRO HG3  H N N 170 
PRO HD2  H N N 171 
PRO HD3  H N N 172 
PRO HXT  H N N 173 
SER N    N N N 174 
SER CA   C N S 175 
SER C    C N N 176 
SER O    O N N 177 
SER CB   C N N 178 
SER OG   O N N 179 
SER OXT  O N N 180 
SER H    H N N 181 
SER H2   H N N 182 
SER HA   H N N 183 
SER HB2  H N N 184 
SER HB3  H N N 185 
SER HG   H N N 186 
SER HXT  H N N 187 
THR N    N N N 188 
THR CA   C N S 189 
THR C    C N N 190 
THR O    O N N 191 
THR CB   C N R 192 
THR OG1  O N N 193 
THR CG2  C N N 194 
THR OXT  O N N 195 
THR H    H N N 196 
THR H2   H N N 197 
THR HA   H N N 198 
THR HB   H N N 199 
THR HG1  H N N 200 
THR HG21 H N N 201 
THR HG22 H N N 202 
THR HG23 H N N 203 
THR HXT  H N N 204 
TRP N    N N N 205 
TRP CA   C N S 206 
TRP C    C N N 207 
TRP O    O N N 208 
TRP CB   C N N 209 
TRP CG   C Y N 210 
TRP CD1  C Y N 211 
TRP CD2  C Y N 212 
TRP NE1  N Y N 213 
TRP CE2  C Y N 214 
TRP CE3  C Y N 215 
TRP CZ2  C Y N 216 
TRP CZ3  C Y N 217 
TRP CH2  C Y N 218 
TRP OXT  O N N 219 
TRP H    H N N 220 
TRP H2   H N N 221 
TRP HA   H N N 222 
TRP HB2  H N N 223 
TRP HB3  H N N 224 
TRP HD1  H N N 225 
TRP HE1  H N N 226 
TRP HE3  H N N 227 
TRP HZ2  H N N 228 
TRP HZ3  H N N 229 
TRP HH2  H N N 230 
TRP HXT  H N N 231 
TYR N    N N N 232 
TYR CA   C N S 233 
TYR C    C N N 234 
TYR O    O N N 235 
TYR CB   C N N 236 
TYR CG   C Y N 237 
TYR CD1  C Y N 238 
TYR CD2  C Y N 239 
TYR CE1  C Y N 240 
TYR CE2  C Y N 241 
TYR CZ   C Y N 242 
TYR OH   O N N 243 
TYR OXT  O N N 244 
TYR H    H N N 245 
TYR H2   H N N 246 
TYR HA   H N N 247 
TYR HB2  H N N 248 
TYR HB3  H N N 249 
TYR HD1  H N N 250 
TYR HD2  H N N 251 
TYR HE1  H N N 252 
TYR HE2  H N N 253 
TYR HH   H N N 254 
TYR HXT  H N N 255 
VAL N    N N N 256 
VAL CA   C N S 257 
VAL C    C N N 258 
VAL O    O N N 259 
VAL CB   C N N 260 
VAL CG1  C N N 261 
VAL CG2  C N N 262 
VAL OXT  O N N 263 
VAL H    H N N 264 
VAL H2   H N N 265 
VAL HA   H N N 266 
VAL HB   H N N 267 
VAL HG11 H N N 268 
VAL HG12 H N N 269 
VAL HG13 H N N 270 
VAL HG21 H N N 271 
VAL HG22 H N N 272 
VAL HG23 H N N 273 
VAL HXT  H N N 274 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ASN N   CA   sing N N 13  
ASN N   H    sing N N 14  
ASN N   H2   sing N N 15  
ASN CA  C    sing N N 16  
ASN CA  CB   sing N N 17  
ASN CA  HA   sing N N 18  
ASN C   O    doub N N 19  
ASN C   OXT  sing N N 20  
ASN CB  CG   sing N N 21  
ASN CB  HB2  sing N N 22  
ASN CB  HB3  sing N N 23  
ASN CG  OD1  doub N N 24  
ASN CG  ND2  sing N N 25  
ASN ND2 HD21 sing N N 26  
ASN ND2 HD22 sing N N 27  
ASN OXT HXT  sing N N 28  
ASP N   CA   sing N N 29  
ASP N   H    sing N N 30  
ASP N   H2   sing N N 31  
ASP CA  C    sing N N 32  
ASP CA  CB   sing N N 33  
ASP CA  HA   sing N N 34  
ASP C   O    doub N N 35  
ASP C   OXT  sing N N 36  
ASP CB  CG   sing N N 37  
ASP CB  HB2  sing N N 38  
ASP CB  HB3  sing N N 39  
ASP CG  OD1  doub N N 40  
ASP CG  OD2  sing N N 41  
ASP OD2 HD2  sing N N 42  
ASP OXT HXT  sing N N 43  
CYS N   CA   sing N N 44  
CYS N   H    sing N N 45  
CYS N   H2   sing N N 46  
CYS CA  C    sing N N 47  
CYS CA  CB   sing N N 48  
CYS CA  HA   sing N N 49  
CYS C   O    doub N N 50  
CYS C   OXT  sing N N 51  
CYS CB  SG   sing N N 52  
CYS CB  HB2  sing N N 53  
CYS CB  HB3  sing N N 54  
CYS SG  HG   sing N N 55  
CYS OXT HXT  sing N N 56  
GLN N   CA   sing N N 57  
GLN N   H    sing N N 58  
GLN N   H2   sing N N 59  
GLN CA  C    sing N N 60  
GLN CA  CB   sing N N 61  
GLN CA  HA   sing N N 62  
GLN C   O    doub N N 63  
GLN C   OXT  sing N N 64  
GLN CB  CG   sing N N 65  
GLN CB  HB2  sing N N 66  
GLN CB  HB3  sing N N 67  
GLN CG  CD   sing N N 68  
GLN CG  HG2  sing N N 69  
GLN CG  HG3  sing N N 70  
GLN CD  OE1  doub N N 71  
GLN CD  NE2  sing N N 72  
GLN NE2 HE21 sing N N 73  
GLN NE2 HE22 sing N N 74  
GLN OXT HXT  sing N N 75  
GLU N   CA   sing N N 76  
GLU N   H    sing N N 77  
GLU N   H2   sing N N 78  
GLU CA  C    sing N N 79  
GLU CA  CB   sing N N 80  
GLU CA  HA   sing N N 81  
GLU C   O    doub N N 82  
GLU C   OXT  sing N N 83  
GLU CB  CG   sing N N 84  
GLU CB  HB2  sing N N 85  
GLU CB  HB3  sing N N 86  
GLU CG  CD   sing N N 87  
GLU CG  HG2  sing N N 88  
GLU CG  HG3  sing N N 89  
GLU CD  OE1  doub N N 90  
GLU CD  OE2  sing N N 91  
GLU OE2 HE2  sing N N 92  
GLU OXT HXT  sing N N 93  
GLY N   CA   sing N N 94  
GLY N   H    sing N N 95  
GLY N   H2   sing N N 96  
GLY CA  C    sing N N 97  
GLY CA  HA2  sing N N 98  
GLY CA  HA3  sing N N 99  
GLY C   O    doub N N 100 
GLY C   OXT  sing N N 101 
GLY OXT HXT  sing N N 102 
ILE N   CA   sing N N 103 
ILE N   H    sing N N 104 
ILE N   H2   sing N N 105 
ILE CA  C    sing N N 106 
ILE CA  CB   sing N N 107 
ILE CA  HA   sing N N 108 
ILE C   O    doub N N 109 
ILE C   OXT  sing N N 110 
ILE CB  CG1  sing N N 111 
ILE CB  CG2  sing N N 112 
ILE CB  HB   sing N N 113 
ILE CG1 CD1  sing N N 114 
ILE CG1 HG12 sing N N 115 
ILE CG1 HG13 sing N N 116 
ILE CG2 HG21 sing N N 117 
ILE CG2 HG22 sing N N 118 
ILE CG2 HG23 sing N N 119 
ILE CD1 HD11 sing N N 120 
ILE CD1 HD12 sing N N 121 
ILE CD1 HD13 sing N N 122 
ILE OXT HXT  sing N N 123 
LYS N   CA   sing N N 124 
LYS N   H    sing N N 125 
LYS N   H2   sing N N 126 
LYS CA  C    sing N N 127 
LYS CA  CB   sing N N 128 
LYS CA  HA   sing N N 129 
LYS C   O    doub N N 130 
LYS C   OXT  sing N N 131 
LYS CB  CG   sing N N 132 
LYS CB  HB2  sing N N 133 
LYS CB  HB3  sing N N 134 
LYS CG  CD   sing N N 135 
LYS CG  HG2  sing N N 136 
LYS CG  HG3  sing N N 137 
LYS CD  CE   sing N N 138 
LYS CD  HD2  sing N N 139 
LYS CD  HD3  sing N N 140 
LYS CE  NZ   sing N N 141 
LYS CE  HE2  sing N N 142 
LYS CE  HE3  sing N N 143 
LYS NZ  HZ1  sing N N 144 
LYS NZ  HZ2  sing N N 145 
LYS NZ  HZ3  sing N N 146 
LYS OXT HXT  sing N N 147 
PRO N   CA   sing N N 148 
PRO N   CD   sing N N 149 
PRO N   H    sing N N 150 
PRO CA  C    sing N N 151 
PRO CA  CB   sing N N 152 
PRO CA  HA   sing N N 153 
PRO C   O    doub N N 154 
PRO C   OXT  sing N N 155 
PRO CB  CG   sing N N 156 
PRO CB  HB2  sing N N 157 
PRO CB  HB3  sing N N 158 
PRO CG  CD   sing N N 159 
PRO CG  HG2  sing N N 160 
PRO CG  HG3  sing N N 161 
PRO CD  HD2  sing N N 162 
PRO CD  HD3  sing N N 163 
PRO OXT HXT  sing N N 164 
SER N   CA   sing N N 165 
SER N   H    sing N N 166 
SER N   H2   sing N N 167 
SER CA  C    sing N N 168 
SER CA  CB   sing N N 169 
SER CA  HA   sing N N 170 
SER C   O    doub N N 171 
SER C   OXT  sing N N 172 
SER CB  OG   sing N N 173 
SER CB  HB2  sing N N 174 
SER CB  HB3  sing N N 175 
SER OG  HG   sing N N 176 
SER OXT HXT  sing N N 177 
THR N   CA   sing N N 178 
THR N   H    sing N N 179 
THR N   H2   sing N N 180 
THR CA  C    sing N N 181 
THR CA  CB   sing N N 182 
THR CA  HA   sing N N 183 
THR C   O    doub N N 184 
THR C   OXT  sing N N 185 
THR CB  OG1  sing N N 186 
THR CB  CG2  sing N N 187 
THR CB  HB   sing N N 188 
THR OG1 HG1  sing N N 189 
THR CG2 HG21 sing N N 190 
THR CG2 HG22 sing N N 191 
THR CG2 HG23 sing N N 192 
THR OXT HXT  sing N N 193 
TRP N   CA   sing N N 194 
TRP N   H    sing N N 195 
TRP N   H2   sing N N 196 
TRP CA  C    sing N N 197 
TRP CA  CB   sing N N 198 
TRP CA  HA   sing N N 199 
TRP C   O    doub N N 200 
TRP C   OXT  sing N N 201 
TRP CB  CG   sing N N 202 
TRP CB  HB2  sing N N 203 
TRP CB  HB3  sing N N 204 
TRP CG  CD1  doub Y N 205 
TRP CG  CD2  sing Y N 206 
TRP CD1 NE1  sing Y N 207 
TRP CD1 HD1  sing N N 208 
TRP CD2 CE2  doub Y N 209 
TRP CD2 CE3  sing Y N 210 
TRP NE1 CE2  sing Y N 211 
TRP NE1 HE1  sing N N 212 
TRP CE2 CZ2  sing Y N 213 
TRP CE3 CZ3  doub Y N 214 
TRP CE3 HE3  sing N N 215 
TRP CZ2 CH2  doub Y N 216 
TRP CZ2 HZ2  sing N N 217 
TRP CZ3 CH2  sing Y N 218 
TRP CZ3 HZ3  sing N N 219 
TRP CH2 HH2  sing N N 220 
TRP OXT HXT  sing N N 221 
TYR N   CA   sing N N 222 
TYR N   H    sing N N 223 
TYR N   H2   sing N N 224 
TYR CA  C    sing N N 225 
TYR CA  CB   sing N N 226 
TYR CA  HA   sing N N 227 
TYR C   O    doub N N 228 
TYR C   OXT  sing N N 229 
TYR CB  CG   sing N N 230 
TYR CB  HB2  sing N N 231 
TYR CB  HB3  sing N N 232 
TYR CG  CD1  doub Y N 233 
TYR CG  CD2  sing Y N 234 
TYR CD1 CE1  sing Y N 235 
TYR CD1 HD1  sing N N 236 
TYR CD2 CE2  doub Y N 237 
TYR CD2 HD2  sing N N 238 
TYR CE1 CZ   doub Y N 239 
TYR CE1 HE1  sing N N 240 
TYR CE2 CZ   sing Y N 241 
TYR CE2 HE2  sing N N 242 
TYR CZ  OH   sing N N 243 
TYR OH  HH   sing N N 244 
TYR OXT HXT  sing N N 245 
VAL N   CA   sing N N 246 
VAL N   H    sing N N 247 
VAL N   H2   sing N N 248 
VAL CA  C    sing N N 249 
VAL CA  CB   sing N N 250 
VAL CA  HA   sing N N 251 
VAL C   O    doub N N 252 
VAL C   OXT  sing N N 253 
VAL CB  CG1  sing N N 254 
VAL CB  CG2  sing N N 255 
VAL CB  HB   sing N N 256 
VAL CG1 HG11 sing N N 257 
VAL CG1 HG12 sing N N 258 
VAL CG1 HG13 sing N N 259 
VAL CG2 HG21 sing N N 260 
VAL CG2 HG22 sing N N 261 
VAL CG2 HG23 sing N N 262 
VAL OXT HXT  sing N N 263 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 DRX Bruker 500 ? 
2 DRX Bruker 600 ? 
# 
_atom_sites.entry_id                    1E8P 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_