data_1EAA # _entry.id 1EAA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1EAA WWPDB D_1000172978 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1EAA _pdbx_database_status.recvd_initial_deposition_date 1992-12-16 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mattevi, A.' 1 'Hol, W.G.J.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Crystallographic analysis of substrate binding and catalysis in dihydrolipoyl transacetylase (E2p).' Biochemistry 32 3887 3901 1993 BICHAW US 0006-2960 0033 ? 8471601 10.1021/bi00066a007 1 ;Three-Dimensional Structure of Lipoamide Dehydrogenase from Pseudomonas Fluorescens at 2.8 Angstroms Resolution. Analysis of Redox and Thermostability Properties ; J.Mol.Biol. 230 1200 ? 1993 JMOBAK UK 0022-2836 0070 ? ? ? 2 ;Refined Crystal Structure of the Catalytic Domain of Dihydrolipoyl Transacetylase (E2P) from Azotobacter Vinelandii at 2.6 Angstroms Resolution ; J.Mol.Biol. 230 1183 ? 1993 JMOBAK UK 0022-2836 0070 ? ? ? 3 'Crystallographic Analysis of Substrate Binding and Catalysis in Dihydrolipoyl Transacetylase (E2P)' Biochemistry 32 3887 ? 1993 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Mattevi, A.' 1 primary 'Obmolova, G.' 2 primary 'Kalk, K.H.' 3 primary 'Teplyakov, A.' 4 primary 'Hol, W.G.' 5 1 'Mattevi, A.' 6 1 'Obmolova, G.' 7 1 'Kalk, K.H.' 8 1 'Van Berkel, W.J.' 9 1 'Hol, W.G.' 10 2 'Mattevi, A.' 11 2 'Obmolova, G.' 12 2 'Kalk, K.H.' 13 2 'Westphal, A.H.' 14 2 'De Kok, A.' 15 2 'Hol, W.G.' 16 3 'Mattevi, A.' 17 3 'Obmolova, G.' 18 3 'Kalk, K.H.' 19 3 'Teplyakov, A.' 20 3 'Hol, W.G.' 21 # _cell.entry_id 1EAA _cell.length_a 224.770 _cell.length_b 224.770 _cell.length_c 224.770 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 96 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1EAA _symmetry.space_group_name_H-M 'F 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 209 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man DIHYDROLIPOYL-TRANSACETYLASE 26241.748 1 2.3.1.12 ? ? ? 2 water nat water 18.015 37 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAKKAGVKLTVLPLLLKAC AYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGAC FTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRA ILL ; _entity_poly.pdbx_seq_one_letter_code_can ;IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAKKAGVKLTVLPLLLKAC AYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGAC FTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRA ILL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 PRO n 1 3 PRO n 1 4 ILE n 1 5 PRO n 1 6 PRO n 1 7 VAL n 1 8 ASP n 1 9 PHE n 1 10 ALA n 1 11 LYS n 1 12 TYR n 1 13 GLY n 1 14 GLU n 1 15 ILE n 1 16 GLU n 1 17 GLU n 1 18 VAL n 1 19 PRO n 1 20 MET n 1 21 THR n 1 22 ARG n 1 23 LEU n 1 24 MET n 1 25 GLN n 1 26 ILE n 1 27 GLY n 1 28 ALA n 1 29 THR n 1 30 ASN n 1 31 LEU n 1 32 HIS n 1 33 ARG n 1 34 SER n 1 35 TRP n 1 36 LEU n 1 37 ASN n 1 38 VAL n 1 39 PRO n 1 40 HIS n 1 41 VAL n 1 42 THR n 1 43 GLN n 1 44 PHE n 1 45 GLU n 1 46 SER n 1 47 ALA n 1 48 ASP n 1 49 ILE n 1 50 THR n 1 51 GLU n 1 52 LEU n 1 53 GLU n 1 54 ALA n 1 55 PHE n 1 56 ARG n 1 57 VAL n 1 58 ALA n 1 59 GLN n 1 60 LYS n 1 61 ALA n 1 62 VAL n 1 63 ALA n 1 64 LYS n 1 65 LYS n 1 66 ALA n 1 67 GLY n 1 68 VAL n 1 69 LYS n 1 70 LEU n 1 71 THR n 1 72 VAL n 1 73 LEU n 1 74 PRO n 1 75 LEU n 1 76 LEU n 1 77 LEU n 1 78 LYS n 1 79 ALA n 1 80 CYS n 1 81 ALA n 1 82 TYR n 1 83 LEU n 1 84 LEU n 1 85 LYS n 1 86 GLU n 1 87 LEU n 1 88 PRO n 1 89 ASP n 1 90 PHE n 1 91 ASN n 1 92 SER n 1 93 SER n 1 94 LEU n 1 95 ALA n 1 96 PRO n 1 97 SER n 1 98 GLY n 1 99 GLN n 1 100 ALA n 1 101 LEU n 1 102 ILE n 1 103 ARG n 1 104 LYS n 1 105 LYS n 1 106 TYR n 1 107 VAL n 1 108 HIS n 1 109 ILE n 1 110 GLY n 1 111 PHE n 1 112 ALA n 1 113 VAL n 1 114 ASP n 1 115 THR n 1 116 PRO n 1 117 ASP n 1 118 GLY n 1 119 LEU n 1 120 LEU n 1 121 VAL n 1 122 PRO n 1 123 VAL n 1 124 ILE n 1 125 ARG n 1 126 ASN n 1 127 VAL n 1 128 ASP n 1 129 GLN n 1 130 LYS n 1 131 SER n 1 132 LEU n 1 133 LEU n 1 134 GLN n 1 135 LEU n 1 136 ALA n 1 137 ALA n 1 138 GLU n 1 139 ALA n 1 140 ALA n 1 141 GLU n 1 142 LEU n 1 143 ALA n 1 144 GLU n 1 145 LYS n 1 146 ALA n 1 147 ARG n 1 148 SER n 1 149 LYS n 1 150 LYS n 1 151 LEU n 1 152 GLY n 1 153 ALA n 1 154 ASP n 1 155 ALA n 1 156 MET n 1 157 GLN n 1 158 GLY n 1 159 ALA n 1 160 CYS n 1 161 PHE n 1 162 THR n 1 163 ILE n 1 164 SER n 1 165 SER n 1 166 LEU n 1 167 GLY n 1 168 HIS n 1 169 ILE n 1 170 GLY n 1 171 GLY n 1 172 THR n 1 173 ALA n 1 174 PHE n 1 175 THR n 1 176 PRO n 1 177 ILE n 1 178 VAL n 1 179 ASN n 1 180 ALA n 1 181 PRO n 1 182 GLU n 1 183 VAL n 1 184 ALA n 1 185 ILE n 1 186 LEU n 1 187 GLY n 1 188 VAL n 1 189 SER n 1 190 LYS n 1 191 ALA n 1 192 SER n 1 193 MET n 1 194 GLN n 1 195 PRO n 1 196 VAL n 1 197 TRP n 1 198 ASP n 1 199 GLY n 1 200 LYS n 1 201 ALA n 1 202 PHE n 1 203 GLN n 1 204 PRO n 1 205 ARG n 1 206 LEU n 1 207 MET n 1 208 LEU n 1 209 PRO n 1 210 LEU n 1 211 SER n 1 212 LEU n 1 213 SER n 1 214 TYR n 1 215 ASP n 1 216 HIS n 1 217 ARG n 1 218 VAL n 1 219 ILE n 1 220 ASN n 1 221 GLY n 1 222 ALA n 1 223 ALA n 1 224 ALA n 1 225 ALA n 1 226 ARG n 1 227 PHE n 1 228 THR n 1 229 LYS n 1 230 ARG n 1 231 LEU n 1 232 GLY n 1 233 ASP n 1 234 LEU n 1 235 LEU n 1 236 ALA n 1 237 ASP n 1 238 ILE n 1 239 ARG n 1 240 ALA n 1 241 ILE n 1 242 LEU n 1 243 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Azotobacter _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Azotobacter vinelandii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 354 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ODP2_AZOVI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P10802 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;SEIIRVPDIGGDGEVIELLVKTGDLIEVEQGLVVLESAKASMEVPSPKAGVVKSVSVKLGDKLKEGDAIIELEPAAGAAA APAEAAAVPAAPTQAVDEAEAPSPGASATPAPAAASQEVRVPDIGSAGKARVIEVLVKAGDQVQAEQSLIVLESDKASME IPSPASGVVESVAIQLNAEVGTGDLILTLRTTGAQAQPTAPAAAAAASPAPAPLAPAAAGPQEVKVPDIGSAGKARVIEV LVKAGDQVQAEQSLIVLESDKASMEIPSPAAGVVESVAVQLNAEVGTGDQILTLRVAGAAPSGPRARGSPGQAAAAPGAA PAPAPVGAPSRNGAKVHAGPAVRQLAREFGVELAAINSTGPRGRILKEDVQAYVKAMMQKAKEAPAAGAASGAGIPPIPP VDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAEKAGVKLTVLPLLLKACAYLLKE LPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSL GHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRAILL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1EAA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 243 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P10802 _struct_ref_seq.db_align_beg 395 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 637 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 395 _struct_ref_seq.pdbx_auth_seq_align_end 637 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1EAA _struct_ref_seq_dif.mon_id LYS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 64 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P10802 _struct_ref_seq_dif.db_mon_id GLU _struct_ref_seq_dif.pdbx_seq_db_seq_num 458 _struct_ref_seq_dif.details CONFLICT _struct_ref_seq_dif.pdbx_auth_seq_num 458 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1EAA _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 4.50 _exptl_crystal.density_percent_sol 72.70 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine.entry_id 1EAA _refine.ls_number_reflns_obs 10344 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10.0 _refine.ls_d_res_high 2.6 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.1870000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1870000 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1812 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 37 _refine_hist.number_atoms_total 1849 _refine_hist.d_res_high 2.6 _refine_hist.d_res_low 10.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.017 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 3.3 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 25.9 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1EAA _struct.title 'ATOMIC STRUCTURE OF THE CUBIC CORE OF THE PYRUVATE DEHYDROGENASE MULTIENZYME COMPLEX' _struct.pdbx_descriptor 'DIHYDROLIPOYL TRANSACETYLASE (E.C.2.3.1.12) (CATALYTIC DOMAIN (RESIDUES 382-637)) NATIVE STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1EAA _struct_keywords.pdbx_keywords 'DIHYDROLIPOAMIDE ACETYLTRANSFERASE' _struct_keywords.text 'DIHYDROLIPOAMIDE ACETYLTRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 22 ? ASN A 37 ? ARG A 416 ASN A 431 1 ? 16 HELX_P HELX_P2 2 THR A 50 ? LYS A 65 ? THR A 444 LYS A 459 1 ? 16 HELX_P HELX_P3 3 VAL A 72 ? GLU A 86 ? VAL A 466 GLU A 480 1 ? 15 HELX_P HELX_P4 4 LEU A 132 ? ARG A 147 ? LEU A 526 ARG A 541 1 ? 16 HELX_P HELX_P5 5 GLY A 221 ? ALA A 236 ? GLY A 615 ALA A 630 1 ? 16 HELX_P HELX_P6 6 ILE A 238 ? LEU A 243 ? ILE A 632 LEU A 637 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 180 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 574 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 181 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 575 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 17.45 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? parallel B 4 5 ? parallel B 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 92 ? LEU A 94 ? SER A 486 LEU A 488 A 2 LEU A 101 ? LYS A 105 ? LEU A 495 LYS A 499 B 1 HIS A 40 ? ASP A 48 ? HIS A 434 ASP A 442 B 2 PHE A 202 ? ASP A 215 ? PHE A 596 ASP A 609 B 3 ALA A 184 ? TRP A 197 ? ALA A 578 TRP A 591 B 4 PHE A 161 ? LEU A 166 ? PHE A 555 LEU A 560 B 5 ILE A 109 ? ASP A 114 ? ILE A 503 ASP A 508 B 6 LEU A 119 ? ILE A 124 ? LEU A 513 ILE A 518 # _database_PDB_matrix.entry_id 1EAA _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1EAA _atom_sites.fract_transf_matrix[1][1] 0.004449 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.004449 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004449 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # _atom_sites_footnote.id 1 _atom_sites_footnote.text 'RESIDUE 575 IS A CIS PROLINE.' # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 395 395 ILE ILE A . n A 1 2 PRO 2 396 396 PRO PRO A . n A 1 3 PRO 3 397 397 PRO PRO A . n A 1 4 ILE 4 398 398 ILE ILE A . n A 1 5 PRO 5 399 399 PRO PRO A . n A 1 6 PRO 6 400 400 PRO PRO A . n A 1 7 VAL 7 401 401 VAL VAL A . n A 1 8 ASP 8 402 402 ASP ASP A . n A 1 9 PHE 9 403 403 PHE PHE A . n A 1 10 ALA 10 404 404 ALA ALA A . n A 1 11 LYS 11 405 405 LYS LYS A . n A 1 12 TYR 12 406 406 TYR TYR A . n A 1 13 GLY 13 407 407 GLY GLY A . n A 1 14 GLU 14 408 408 GLU GLU A . n A 1 15 ILE 15 409 409 ILE ILE A . n A 1 16 GLU 16 410 410 GLU GLU A . n A 1 17 GLU 17 411 411 GLU GLU A . n A 1 18 VAL 18 412 412 VAL VAL A . n A 1 19 PRO 19 413 413 PRO PRO A . n A 1 20 MET 20 414 414 MET MET A . n A 1 21 THR 21 415 415 THR THR A . n A 1 22 ARG 22 416 416 ARG ARG A . n A 1 23 LEU 23 417 417 LEU LEU A . n A 1 24 MET 24 418 418 MET MET A . n A 1 25 GLN 25 419 419 GLN GLN A . n A 1 26 ILE 26 420 420 ILE ILE A . n A 1 27 GLY 27 421 421 GLY GLY A . n A 1 28 ALA 28 422 422 ALA ALA A . n A 1 29 THR 29 423 423 THR THR A . n A 1 30 ASN 30 424 424 ASN ASN A . n A 1 31 LEU 31 425 425 LEU LEU A . n A 1 32 HIS 32 426 426 HIS HIS A . n A 1 33 ARG 33 427 427 ARG ARG A . n A 1 34 SER 34 428 428 SER SER A . n A 1 35 TRP 35 429 429 TRP TRP A . n A 1 36 LEU 36 430 430 LEU LEU A . n A 1 37 ASN 37 431 431 ASN ASN A . n A 1 38 VAL 38 432 432 VAL VAL A . n A 1 39 PRO 39 433 433 PRO PRO A . n A 1 40 HIS 40 434 434 HIS HIS A . n A 1 41 VAL 41 435 435 VAL VAL A . n A 1 42 THR 42 436 436 THR THR A . n A 1 43 GLN 43 437 437 GLN GLN A . n A 1 44 PHE 44 438 438 PHE PHE A . n A 1 45 GLU 45 439 439 GLU GLU A . n A 1 46 SER 46 440 440 SER SER A . n A 1 47 ALA 47 441 441 ALA ALA A . n A 1 48 ASP 48 442 442 ASP ASP A . n A 1 49 ILE 49 443 443 ILE ILE A . n A 1 50 THR 50 444 444 THR THR A . n A 1 51 GLU 51 445 445 GLU GLU A . n A 1 52 LEU 52 446 446 LEU LEU A . n A 1 53 GLU 53 447 447 GLU GLU A . n A 1 54 ALA 54 448 448 ALA ALA A . n A 1 55 PHE 55 449 449 PHE PHE A . n A 1 56 ARG 56 450 450 ARG ARG A . n A 1 57 VAL 57 451 451 VAL VAL A . n A 1 58 ALA 58 452 452 ALA ALA A . n A 1 59 GLN 59 453 453 GLN GLN A . n A 1 60 LYS 60 454 454 LYS LYS A . n A 1 61 ALA 61 455 455 ALA ALA A . n A 1 62 VAL 62 456 456 VAL VAL A . n A 1 63 ALA 63 457 457 ALA ALA A . n A 1 64 LYS 64 458 458 LYS LYS A . n A 1 65 LYS 65 459 459 LYS LYS A . n A 1 66 ALA 66 460 460 ALA ALA A . n A 1 67 GLY 67 461 461 GLY GLY A . n A 1 68 VAL 68 462 462 VAL VAL A . n A 1 69 LYS 69 463 463 LYS LYS A . n A 1 70 LEU 70 464 464 LEU LEU A . n A 1 71 THR 71 465 465 THR THR A . n A 1 72 VAL 72 466 466 VAL VAL A . n A 1 73 LEU 73 467 467 LEU LEU A . n A 1 74 PRO 74 468 468 PRO PRO A . n A 1 75 LEU 75 469 469 LEU LEU A . n A 1 76 LEU 76 470 470 LEU LEU A . n A 1 77 LEU 77 471 471 LEU LEU A . n A 1 78 LYS 78 472 472 LYS LYS A . n A 1 79 ALA 79 473 473 ALA ALA A . n A 1 80 CYS 80 474 474 CYS CYS A . n A 1 81 ALA 81 475 475 ALA ALA A . n A 1 82 TYR 82 476 476 TYR TYR A . n A 1 83 LEU 83 477 477 LEU LEU A . n A 1 84 LEU 84 478 478 LEU LEU A . n A 1 85 LYS 85 479 479 LYS LYS A . n A 1 86 GLU 86 480 480 GLU GLU A . n A 1 87 LEU 87 481 481 LEU LEU A . n A 1 88 PRO 88 482 482 PRO PRO A . n A 1 89 ASP 89 483 483 ASP ASP A . n A 1 90 PHE 90 484 484 PHE PHE A . n A 1 91 ASN 91 485 485 ASN ASN A . n A 1 92 SER 92 486 486 SER SER A . n A 1 93 SER 93 487 487 SER SER A . n A 1 94 LEU 94 488 488 LEU LEU A . n A 1 95 ALA 95 489 489 ALA ALA A . n A 1 96 PRO 96 490 490 PRO PRO A . n A 1 97 SER 97 491 491 SER SER A . n A 1 98 GLY 98 492 492 GLY GLY A . n A 1 99 GLN 99 493 493 GLN GLN A . n A 1 100 ALA 100 494 494 ALA ALA A . n A 1 101 LEU 101 495 495 LEU LEU A . n A 1 102 ILE 102 496 496 ILE ILE A . n A 1 103 ARG 103 497 497 ARG ARG A . n A 1 104 LYS 104 498 498 LYS LYS A . n A 1 105 LYS 105 499 499 LYS LYS A . n A 1 106 TYR 106 500 500 TYR TYR A . n A 1 107 VAL 107 501 501 VAL VAL A . n A 1 108 HIS 108 502 502 HIS HIS A . n A 1 109 ILE 109 503 503 ILE ILE A . n A 1 110 GLY 110 504 504 GLY GLY A . n A 1 111 PHE 111 505 505 PHE PHE A . n A 1 112 ALA 112 506 506 ALA ALA A . n A 1 113 VAL 113 507 507 VAL VAL A . n A 1 114 ASP 114 508 508 ASP ASP A . n A 1 115 THR 115 509 509 THR THR A . n A 1 116 PRO 116 510 510 PRO PRO A . n A 1 117 ASP 117 511 511 ASP ASP A . n A 1 118 GLY 118 512 512 GLY GLY A . n A 1 119 LEU 119 513 513 LEU LEU A . n A 1 120 LEU 120 514 514 LEU LEU A . n A 1 121 VAL 121 515 515 VAL VAL A . n A 1 122 PRO 122 516 516 PRO PRO A . n A 1 123 VAL 123 517 517 VAL VAL A . n A 1 124 ILE 124 518 518 ILE ILE A . n A 1 125 ARG 125 519 519 ARG ARG A . n A 1 126 ASN 126 520 520 ASN ASN A . n A 1 127 VAL 127 521 521 VAL VAL A . n A 1 128 ASP 128 522 522 ASP ASP A . n A 1 129 GLN 129 523 523 GLN GLN A . n A 1 130 LYS 130 524 524 LYS LYS A . n A 1 131 SER 131 525 525 SER SER A . n A 1 132 LEU 132 526 526 LEU LEU A . n A 1 133 LEU 133 527 527 LEU LEU A . n A 1 134 GLN 134 528 528 GLN GLN A . n A 1 135 LEU 135 529 529 LEU LEU A . n A 1 136 ALA 136 530 530 ALA ALA A . n A 1 137 ALA 137 531 531 ALA ALA A . n A 1 138 GLU 138 532 532 GLU GLU A . n A 1 139 ALA 139 533 533 ALA ALA A . n A 1 140 ALA 140 534 534 ALA ALA A . n A 1 141 GLU 141 535 535 GLU GLU A . n A 1 142 LEU 142 536 536 LEU LEU A . n A 1 143 ALA 143 537 537 ALA ALA A . n A 1 144 GLU 144 538 538 GLU GLU A . n A 1 145 LYS 145 539 539 LYS LYS A . n A 1 146 ALA 146 540 540 ALA ALA A . n A 1 147 ARG 147 541 541 ARG ARG A . n A 1 148 SER 148 542 542 SER SER A . n A 1 149 LYS 149 543 543 LYS LYS A . n A 1 150 LYS 150 544 544 LYS LYS A . n A 1 151 LEU 151 545 545 LEU LEU A . n A 1 152 GLY 152 546 546 GLY GLY A . n A 1 153 ALA 153 547 547 ALA ALA A . n A 1 154 ASP 154 548 548 ASP ASP A . n A 1 155 ALA 155 549 549 ALA ALA A . n A 1 156 MET 156 550 550 MET MET A . n A 1 157 GLN 157 551 551 GLN GLN A . n A 1 158 GLY 158 552 552 GLY GLY A . n A 1 159 ALA 159 553 553 ALA ALA A . n A 1 160 CYS 160 554 554 CYS CYS A . n A 1 161 PHE 161 555 555 PHE PHE A . n A 1 162 THR 162 556 556 THR THR A . n A 1 163 ILE 163 557 557 ILE ILE A . n A 1 164 SER 164 558 558 SER SER A . n A 1 165 SER 165 559 559 SER SER A . n A 1 166 LEU 166 560 560 LEU LEU A . n A 1 167 GLY 167 561 561 GLY GLY A . n A 1 168 HIS 168 562 562 HIS HIS A . n A 1 169 ILE 169 563 563 ILE ILE A . n A 1 170 GLY 170 564 564 GLY GLY A . n A 1 171 GLY 171 565 565 GLY GLY A . n A 1 172 THR 172 566 566 THR THR A . n A 1 173 ALA 173 567 567 ALA ALA A . n A 1 174 PHE 174 568 568 PHE PHE A . n A 1 175 THR 175 569 569 THR THR A . n A 1 176 PRO 176 570 570 PRO PRO A . n A 1 177 ILE 177 571 571 ILE ILE A . n A 1 178 VAL 178 572 572 VAL VAL A . n A 1 179 ASN 179 573 573 ASN ASN A . n A 1 180 ALA 180 574 574 ALA ALA A . n A 1 181 PRO 181 575 575 PRO PRO A . n A 1 182 GLU 182 576 576 GLU GLU A . n A 1 183 VAL 183 577 577 VAL VAL A . n A 1 184 ALA 184 578 578 ALA ALA A . n A 1 185 ILE 185 579 579 ILE ILE A . n A 1 186 LEU 186 580 580 LEU LEU A . n A 1 187 GLY 187 581 581 GLY GLY A . n A 1 188 VAL 188 582 582 VAL VAL A . n A 1 189 SER 189 583 583 SER SER A . n A 1 190 LYS 190 584 584 LYS LYS A . n A 1 191 ALA 191 585 585 ALA ALA A . n A 1 192 SER 192 586 586 SER SER A . n A 1 193 MET 193 587 587 MET MET A . n A 1 194 GLN 194 588 588 GLN GLN A . n A 1 195 PRO 195 589 589 PRO PRO A . n A 1 196 VAL 196 590 590 VAL VAL A . n A 1 197 TRP 197 591 591 TRP TRP A . n A 1 198 ASP 198 592 592 ASP ASP A . n A 1 199 GLY 199 593 593 GLY GLY A . n A 1 200 LYS 200 594 594 LYS LYS A . n A 1 201 ALA 201 595 595 ALA ALA A . n A 1 202 PHE 202 596 596 PHE PHE A . n A 1 203 GLN 203 597 597 GLN GLN A . n A 1 204 PRO 204 598 598 PRO PRO A . n A 1 205 ARG 205 599 599 ARG ARG A . n A 1 206 LEU 206 600 600 LEU LEU A . n A 1 207 MET 207 601 601 MET MET A . n A 1 208 LEU 208 602 602 LEU LEU A . n A 1 209 PRO 209 603 603 PRO PRO A . n A 1 210 LEU 210 604 604 LEU LEU A . n A 1 211 SER 211 605 605 SER SER A . n A 1 212 LEU 212 606 606 LEU LEU A . n A 1 213 SER 213 607 607 SER SER A . n A 1 214 TYR 214 608 608 TYR TYR A . n A 1 215 ASP 215 609 609 ASP ASP A . n A 1 216 HIS 216 610 610 HIS HIS A . n A 1 217 ARG 217 611 611 ARG ARG A . n A 1 218 VAL 218 612 612 VAL VAL A . n A 1 219 ILE 219 613 613 ILE ILE A . n A 1 220 ASN 220 614 614 ASN ASN A . n A 1 221 GLY 221 615 615 GLY GLY A . n A 1 222 ALA 222 616 616 ALA ALA A . n A 1 223 ALA 223 617 617 ALA ALA A . n A 1 224 ALA 224 618 618 ALA ALA A . n A 1 225 ALA 225 619 619 ALA ALA A . n A 1 226 ARG 226 620 620 ARG ARG A . n A 1 227 PHE 227 621 621 PHE PHE A . n A 1 228 THR 228 622 622 THR THR A . n A 1 229 LYS 229 623 623 LYS LYS A . n A 1 230 ARG 230 624 624 ARG ARG A . n A 1 231 LEU 231 625 625 LEU LEU A . n A 1 232 GLY 232 626 626 GLY GLY A . n A 1 233 ASP 233 627 627 ASP ASP A . n A 1 234 LEU 234 628 628 LEU LEU A . n A 1 235 LEU 235 629 629 LEU LEU A . n A 1 236 ALA 236 630 630 ALA ALA A . n A 1 237 ASP 237 631 631 ASP ASP A . n A 1 238 ILE 238 632 632 ILE ILE A . n A 1 239 ARG 239 633 633 ARG ARG A . n A 1 240 ALA 240 634 634 ALA ALA A . n A 1 241 ILE 241 635 635 ILE ILE A . n A 1 242 LEU 242 636 636 LEU LEU A . n A 1 243 LEU 243 637 637 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 638 638 HOH HOH A . B 2 HOH 2 639 639 HOH HOH A . B 2 HOH 3 640 640 HOH HOH A . B 2 HOH 4 641 641 HOH HOH A . B 2 HOH 5 642 642 HOH HOH A . B 2 HOH 6 643 643 HOH HOH A . B 2 HOH 7 644 644 HOH HOH A . B 2 HOH 8 645 645 HOH HOH A . B 2 HOH 9 646 646 HOH HOH A . B 2 HOH 10 647 647 HOH HOH A . B 2 HOH 11 648 648 HOH HOH A . B 2 HOH 12 649 649 HOH HOH A . B 2 HOH 13 650 650 HOH HOH A . B 2 HOH 14 651 651 HOH HOH A . B 2 HOH 15 652 652 HOH HOH A . B 2 HOH 16 653 653 HOH HOH A . B 2 HOH 17 654 654 HOH HOH A . B 2 HOH 18 655 655 HOH HOH A . B 2 HOH 19 656 656 HOH HOH A . B 2 HOH 20 657 657 HOH HOH A . B 2 HOH 21 658 658 HOH HOH A . B 2 HOH 22 659 659 HOH HOH A . B 2 HOH 23 660 660 HOH HOH A . B 2 HOH 24 661 661 HOH HOH A . B 2 HOH 25 662 662 HOH HOH A . B 2 HOH 26 663 663 HOH HOH A . B 2 HOH 27 664 664 HOH HOH A . B 2 HOH 28 665 665 HOH HOH A . B 2 HOH 29 666 666 HOH HOH A . B 2 HOH 30 667 667 HOH HOH A . B 2 HOH 31 668 668 HOH HOH A . B 2 HOH 32 669 669 HOH HOH A . B 2 HOH 33 670 670 HOH HOH A . B 2 HOH 34 671 671 HOH HOH A . B 2 HOH 35 672 672 HOH HOH A . B 2 HOH 36 673 673 HOH HOH A . B 2 HOH 37 674 674 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 111680 ? 1 MORE -865 ? 1 'SSA (A^2)' 213600 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 13 'crystal symmetry operation' 13_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 14 'crystal symmetry operation' 14_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 15 'crystal symmetry operation' 15_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 17 'crystal symmetry operation' 17_555 x,z,-y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 18 'crystal symmetry operation' 18_555 -x,z,y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 19_555 -x,-z,-y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 20 'crystal symmetry operation' 20_555 x,-z,y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 21_555 z,y,-x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 22 'crystal symmetry operation' 22_555 z,-y,x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 23 'crystal symmetry operation' 23_555 -z,y,x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 24 'crystal symmetry operation' 24_555 -z,-y,-x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1993-10-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _pdbx_database_remark.id 700 _pdbx_database_remark.text ;SHEET SHEET A IS ACTUALLY A FOUR-STRANDED SHEET. IT CONTAINS TWO ADDITIONAL STRANDS A 3 ILE 409 PRO 413 -1 A 4 THR 566 PHE 568 -1 FROM A THREEFOLD-RELATED SUBUNIT. ; # _pdbx_entry_details.entry_id 1EAA _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;SEQUENCE ADVISORY NOTICE: DIFFERENCE BETWEEN SWISS-PROT AND PDB SEQUENCE. SWISS-PROT ENTRY NAME: ODP2_AZOVI SWISS-PROT RESIDUE PDB SEQRES NAME NUMBER NAME CHAIN SEQ/INSERT CODE GLU 458 LYS 458 ; # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OD1 A ASP 402 ? ? 1_555 OD1 A ASP 402 ? ? 28_555 0.50 2 1 CG A ASP 402 ? ? 1_555 OD1 A ASP 402 ? ? 28_555 1.65 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 NE2 A HIS 426 ? ? CD2 A HIS 426 ? ? 1.305 1.373 -0.068 0.011 N 2 1 NE2 A HIS 562 ? ? CD2 A HIS 562 ? ? 1.307 1.373 -0.066 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A TYR 406 ? ? CG A TYR 406 ? ? CD1 A TYR 406 ? ? 117.38 121.00 -3.62 0.60 N 2 1 CD1 A TRP 429 ? ? CG A TRP 429 ? ? CD2 A TRP 429 ? ? 112.09 106.30 5.79 0.80 N 3 1 CB A LEU 495 ? ? CG A LEU 495 ? ? CD2 A LEU 495 ? ? 100.01 111.00 -10.99 1.70 N 4 1 CA A ARG 497 ? ? CB A ARG 497 ? ? CG A ARG 497 ? ? 96.56 113.40 -16.84 2.20 N 5 1 CB A TYR 500 ? ? CG A TYR 500 ? ? CD2 A TYR 500 ? ? 116.86 121.00 -4.14 0.60 N 6 1 N A VAL 577 ? ? CA A VAL 577 ? ? CB A VAL 577 ? ? 97.46 111.50 -14.04 2.20 N 7 1 CD1 A TRP 591 ? ? CG A TRP 591 ? ? CD2 A TRP 591 ? ? 113.16 106.30 6.86 0.80 N 8 1 CG A TRP 591 ? ? CD1 A TRP 591 ? ? NE1 A TRP 591 ? ? 104.10 110.10 -6.00 1.00 N 9 1 CE2 A TRP 591 ? ? CD2 A TRP 591 ? ? CG A TRP 591 ? ? 101.63 107.30 -5.67 0.80 N 10 1 NE A ARG 599 ? ? CZ A ARG 599 ? ? NH2 A ARG 599 ? ? 124.12 120.30 3.82 0.50 N 11 1 CG A MET 601 ? ? SD A MET 601 ? ? CE A MET 601 ? ? 89.03 100.20 -11.17 1.60 N 12 1 NE A ARG 620 ? ? CZ A ARG 620 ? ? NH1 A ARG 620 ? ? 125.13 120.30 4.83 0.50 N 13 1 NE A ARG 624 ? ? CZ A ARG 624 ? ? NH1 A ARG 624 ? ? 124.98 120.30 4.68 0.50 N 14 1 CA A LEU 637 ? ? CB A LEU 637 ? ? CG A LEU 637 ? ? 134.78 115.30 19.48 2.30 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 465 ? ? -111.77 -168.65 2 1 LEU A 481 ? ? -113.63 74.23 3 1 ASN A 485 ? ? -102.35 54.16 4 1 LYS A 543 ? ? 44.29 18.03 5 1 ALA A 567 ? ? 168.79 154.01 6 1 SER A 583 ? ? -116.68 -159.86 7 1 LYS A 594 ? ? -133.47 -34.52 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 500 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.073 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 416 ? CG ? A ARG 22 CG 2 1 Y 1 A ARG 416 ? CD ? A ARG 22 CD 3 1 Y 1 A ARG 416 ? NE ? A ARG 22 NE 4 1 Y 1 A ARG 416 ? CZ ? A ARG 22 CZ 5 1 Y 1 A ARG 416 ? NH1 ? A ARG 22 NH1 6 1 Y 1 A ARG 416 ? NH2 ? A ARG 22 NH2 7 1 Y 1 A LYS 454 ? CG ? A LYS 60 CG 8 1 Y 1 A LYS 454 ? CD ? A LYS 60 CD 9 1 Y 1 A LYS 454 ? CE ? A LYS 60 CE 10 1 Y 1 A LYS 454 ? NZ ? A LYS 60 NZ 11 1 Y 1 A LYS 458 ? CG ? A LYS 64 CG 12 1 Y 1 A LYS 458 ? CD ? A LYS 64 CD 13 1 Y 1 A LYS 458 ? CE ? A LYS 64 CE 14 1 Y 1 A LYS 458 ? NZ ? A LYS 64 NZ 15 1 Y 1 A LYS 459 ? CG ? A LYS 65 CG 16 1 Y 1 A LYS 459 ? CD ? A LYS 65 CD 17 1 Y 1 A LYS 459 ? CE ? A LYS 65 CE 18 1 Y 1 A LYS 459 ? NZ ? A LYS 65 NZ 19 1 Y 1 A LYS 463 ? CG ? A LYS 69 CG 20 1 Y 1 A LYS 463 ? CD ? A LYS 69 CD 21 1 Y 1 A LYS 463 ? CE ? A LYS 69 CE 22 1 Y 1 A LYS 463 ? NZ ? A LYS 69 NZ 23 1 Y 1 A GLN 493 ? CG ? A GLN 99 CG 24 1 Y 1 A GLN 493 ? CD ? A GLN 99 CD 25 1 Y 1 A GLN 493 ? OE1 ? A GLN 99 OE1 26 1 Y 1 A GLN 493 ? NE2 ? A GLN 99 NE2 27 1 Y 1 A GLU 538 ? CG ? A GLU 144 CG 28 1 Y 1 A GLU 538 ? CD ? A GLU 144 CD 29 1 Y 1 A GLU 538 ? OE1 ? A GLU 144 OE1 30 1 Y 1 A GLU 538 ? OE2 ? A GLU 144 OE2 31 1 Y 1 A LYS 544 ? CG ? A LYS 150 CG 32 1 Y 1 A LYS 544 ? CD ? A LYS 150 CD 33 1 Y 1 A LYS 544 ? CE ? A LYS 150 CE 34 1 Y 1 A LYS 544 ? NZ ? A LYS 150 NZ # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #