data_1EB6 # _entry.id 1EB6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1EB6 pdb_00001eb6 10.2210/pdb1eb6/pdb PDBE EBI-8370 ? ? WWPDB D_1290008370 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2001-11-23 ? 2 'Structure model' 1 1 2011-05-08 ? 3 'Structure model' 1 2 2011-07-13 ? 4 'Structure model' 1 3 2025-04-09 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_database_status 5 4 'Structure model' pdbx_entry_details 6 4 'Structure model' pdbx_modification_feature 7 4 'Structure model' pdbx_struct_conn_angle 8 4 'Structure model' struct_conn 9 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_sf' 4 4 'Structure model' '_pdbx_entry_details.has_protein_modification' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.value' 18 4 'Structure model' '_struct_conn.pdbx_dist_value' 19 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 20 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 25 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 26 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 30 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 31 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 32 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 33 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 34 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1EB6 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2001-07-19 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'McAuley, K.E.' 1 'Jia-Xing, Y.' 2 'Dodson, E.J.' 3 'Lehmbeck, J.' 4 'Ostergaard, P.R.' 5 'Wilson, K.S.' 6 # _citation.id primary _citation.title 'A Quick Solution: Ab Initio Structure Determination of a 19 kDa Metalloproteinase Using Acorn' _citation.journal_abbrev 'Acta Crystallogr.,Sect.D' _citation.journal_volume 57 _citation.page_first 1571 _citation.page_last ? _citation.year 2001 _citation.journal_id_ASTM ABCRE6 _citation.country DK _citation.journal_id_ISSN 0907-4449 _citation.journal_id_CSD 0766 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11679721 _citation.pdbx_database_id_DOI 10.1107/S090744490101335X # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mcauley, K.E.' 1 ? primary 'Jia-Xing, Y.' 2 ? primary 'Dodson, E.J.' 3 ? primary 'Lehmbeck, J.' 4 ? primary 'Ostergaard, P.R.' 5 ? primary 'Wilson, K.S.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'NEUTRAL PROTEASE II' 19031.523 1 3.4.24.39 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 3 ? ? ? ? 4 water nat water 18.015 259 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'NPII, DEUTEROLYSIN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TEVTDCKGDAESSLTTALSNAAKLANQAAEAAESGDESKFEEYFKTTDQQTRTTVAERLRAVAKEAGSTSGGSTTYHCND PYGYCEPNVLAYTLPSKNEIANCDIYYSELPPLAQKCHAQDQATTTLHEFTHAPGVYQPGTEDLGYGYDAATQLSAQDAL NNADSYALYANAIELKC ; _entity_poly.pdbx_seq_one_letter_code_can ;TEVTDCKGDAESSLTTALSNAAKLANQAAEAAESGDESKFEEYFKTTDQQTRTTVAERLRAVAKEAGSTSGGSTTYHCND PYGYCEPNVLAYTLPSKNEIANCDIYYSELPPLAQKCHAQDQATTTLHEFTHAPGVYQPGTEDLGYGYDAATQLSAQDAL NNADSYALYANAIELKC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 1,2-ETHANEDIOL EDO 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 GLU n 1 3 VAL n 1 4 THR n 1 5 ASP n 1 6 CYS n 1 7 LYS n 1 8 GLY n 1 9 ASP n 1 10 ALA n 1 11 GLU n 1 12 SER n 1 13 SER n 1 14 LEU n 1 15 THR n 1 16 THR n 1 17 ALA n 1 18 LEU n 1 19 SER n 1 20 ASN n 1 21 ALA n 1 22 ALA n 1 23 LYS n 1 24 LEU n 1 25 ALA n 1 26 ASN n 1 27 GLN n 1 28 ALA n 1 29 ALA n 1 30 GLU n 1 31 ALA n 1 32 ALA n 1 33 GLU n 1 34 SER n 1 35 GLY n 1 36 ASP n 1 37 GLU n 1 38 SER n 1 39 LYS n 1 40 PHE n 1 41 GLU n 1 42 GLU n 1 43 TYR n 1 44 PHE n 1 45 LYS n 1 46 THR n 1 47 THR n 1 48 ASP n 1 49 GLN n 1 50 GLN n 1 51 THR n 1 52 ARG n 1 53 THR n 1 54 THR n 1 55 VAL n 1 56 ALA n 1 57 GLU n 1 58 ARG n 1 59 LEU n 1 60 ARG n 1 61 ALA n 1 62 VAL n 1 63 ALA n 1 64 LYS n 1 65 GLU n 1 66 ALA n 1 67 GLY n 1 68 SER n 1 69 THR n 1 70 SER n 1 71 GLY n 1 72 GLY n 1 73 SER n 1 74 THR n 1 75 THR n 1 76 TYR n 1 77 HIS n 1 78 CYS n 1 79 ASN n 1 80 ASP n 1 81 PRO n 1 82 TYR n 1 83 GLY n 1 84 TYR n 1 85 CYS n 1 86 GLU n 1 87 PRO n 1 88 ASN n 1 89 VAL n 1 90 LEU n 1 91 ALA n 1 92 TYR n 1 93 THR n 1 94 LEU n 1 95 PRO n 1 96 SER n 1 97 LYS n 1 98 ASN n 1 99 GLU n 1 100 ILE n 1 101 ALA n 1 102 ASN n 1 103 CYS n 1 104 ASP n 1 105 ILE n 1 106 TYR n 1 107 TYR n 1 108 SER n 1 109 GLU n 1 110 LEU n 1 111 PRO n 1 112 PRO n 1 113 LEU n 1 114 ALA n 1 115 GLN n 1 116 LYS n 1 117 CYS n 1 118 HIS n 1 119 ALA n 1 120 GLN n 1 121 ASP n 1 122 GLN n 1 123 ALA n 1 124 THR n 1 125 THR n 1 126 THR n 1 127 LEU n 1 128 HIS n 1 129 GLU n 1 130 PHE n 1 131 THR n 1 132 HIS n 1 133 ALA n 1 134 PRO n 1 135 GLY n 1 136 VAL n 1 137 TYR n 1 138 GLN n 1 139 PRO n 1 140 GLY n 1 141 THR n 1 142 GLU n 1 143 ASP n 1 144 LEU n 1 145 GLY n 1 146 TYR n 1 147 GLY n 1 148 TYR n 1 149 ASP n 1 150 ALA n 1 151 ALA n 1 152 THR n 1 153 GLN n 1 154 LEU n 1 155 SER n 1 156 ALA n 1 157 GLN n 1 158 ASP n 1 159 ALA n 1 160 LEU n 1 161 ASN n 1 162 ASN n 1 163 ALA n 1 164 ASP n 1 165 SER n 1 166 TYR n 1 167 ALA n 1 168 LEU n 1 169 TYR n 1 170 ALA n 1 171 ASN n 1 172 ALA n 1 173 ILE n 1 174 GLU n 1 175 LEU n 1 176 LYS n 1 177 CYS n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'ASPERGILLUS ORYZAE' _entity_src_nat.pdbx_ncbi_taxonomy_id 5062 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 1 THR THR A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 CYS 103 103 103 CYS CYS A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 TYR 107 107 107 TYR TYR A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 CYS 117 117 117 CYS CYS A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 HIS 132 132 132 HIS HIS A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 THR 141 141 141 THR THR A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 TYR 148 148 148 TYR TYR A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 GLN 157 157 157 GLN GLN A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 TYR 166 166 166 TYR TYR A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 ILE 173 173 173 ILE ILE A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 CYS 177 177 177 CYS CYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 178 178 ZN ZN A . C 3 EDO 1 1178 1178 EDO EDO A . D 3 EDO 1 1179 1179 EDO EDO A . E 3 EDO 1 1180 1180 EDO EDO A . F 4 HOH 1 2001 2001 HOH HOH A . F 4 HOH 2 2002 2002 HOH HOH A . F 4 HOH 3 2003 2003 HOH HOH A . F 4 HOH 4 2004 2004 HOH HOH A . F 4 HOH 5 2005 2005 HOH HOH A . F 4 HOH 6 2006 2006 HOH HOH A . F 4 HOH 7 2007 2007 HOH HOH A . F 4 HOH 8 2008 2008 HOH HOH A . F 4 HOH 9 2009 2009 HOH HOH A . F 4 HOH 10 2010 2010 HOH HOH A . F 4 HOH 11 2011 2011 HOH HOH A . F 4 HOH 12 2012 2012 HOH HOH A . F 4 HOH 13 2013 2013 HOH HOH A . F 4 HOH 14 2014 2014 HOH HOH A . F 4 HOH 15 2015 2015 HOH HOH A . F 4 HOH 16 2016 2016 HOH HOH A . F 4 HOH 17 2017 2017 HOH HOH A . F 4 HOH 18 2018 2018 HOH HOH A . F 4 HOH 19 2019 2019 HOH HOH A . F 4 HOH 20 2020 2020 HOH HOH A . F 4 HOH 21 2021 2021 HOH HOH A . F 4 HOH 22 2022 2022 HOH HOH A . F 4 HOH 23 2023 2023 HOH HOH A . F 4 HOH 24 2024 2024 HOH HOH A . F 4 HOH 25 2025 2025 HOH HOH A . F 4 HOH 26 2026 2026 HOH HOH A . F 4 HOH 27 2027 2027 HOH HOH A . F 4 HOH 28 2028 2028 HOH HOH A . F 4 HOH 29 2029 2029 HOH HOH A . F 4 HOH 30 2030 2030 HOH HOH A . F 4 HOH 31 2031 2031 HOH HOH A . F 4 HOH 32 2032 2032 HOH HOH A . F 4 HOH 33 2033 2033 HOH HOH A . F 4 HOH 34 2034 2034 HOH HOH A . F 4 HOH 35 2035 2035 HOH HOH A . F 4 HOH 36 2036 2036 HOH HOH A . F 4 HOH 37 2037 2037 HOH HOH A . F 4 HOH 38 2038 2038 HOH HOH A . F 4 HOH 39 2039 2039 HOH HOH A . F 4 HOH 40 2040 2040 HOH HOH A . F 4 HOH 41 2041 2041 HOH HOH A . F 4 HOH 42 2042 2042 HOH HOH A . F 4 HOH 43 2043 2043 HOH HOH A . F 4 HOH 44 2044 2044 HOH HOH A . F 4 HOH 45 2045 2045 HOH HOH A . F 4 HOH 46 2046 2046 HOH HOH A . F 4 HOH 47 2047 2047 HOH HOH A . F 4 HOH 48 2048 2048 HOH HOH A . F 4 HOH 49 2049 2049 HOH HOH A . F 4 HOH 50 2050 2050 HOH HOH A . F 4 HOH 51 2051 2051 HOH HOH A . F 4 HOH 52 2052 2052 HOH HOH A . F 4 HOH 53 2053 2053 HOH HOH A . F 4 HOH 54 2054 2054 HOH HOH A . F 4 HOH 55 2055 2055 HOH HOH A . F 4 HOH 56 2056 2056 HOH HOH A . F 4 HOH 57 2057 2057 HOH HOH A . F 4 HOH 58 2058 2058 HOH HOH A . F 4 HOH 59 2059 2059 HOH HOH A . F 4 HOH 60 2060 2060 HOH HOH A . F 4 HOH 61 2061 2061 HOH HOH A . F 4 HOH 62 2062 2062 HOH HOH A . F 4 HOH 63 2063 2063 HOH HOH A . F 4 HOH 64 2064 2064 HOH HOH A . F 4 HOH 65 2065 2065 HOH HOH A . F 4 HOH 66 2066 2066 HOH HOH A . F 4 HOH 67 2067 2067 HOH HOH A . F 4 HOH 68 2068 2068 HOH HOH A . F 4 HOH 69 2069 2069 HOH HOH A . F 4 HOH 70 2070 2070 HOH HOH A . F 4 HOH 71 2071 2071 HOH HOH A . F 4 HOH 72 2072 2072 HOH HOH A . F 4 HOH 73 2073 2073 HOH HOH A . F 4 HOH 74 2074 2074 HOH HOH A . F 4 HOH 75 2075 2075 HOH HOH A . F 4 HOH 76 2076 2076 HOH HOH A . F 4 HOH 77 2077 2077 HOH HOH A . F 4 HOH 78 2078 2078 HOH HOH A . F 4 HOH 79 2079 2079 HOH HOH A . F 4 HOH 80 2080 2080 HOH HOH A . F 4 HOH 81 2081 2081 HOH HOH A . F 4 HOH 82 2082 2082 HOH HOH A . F 4 HOH 83 2083 2083 HOH HOH A . F 4 HOH 84 2084 2084 HOH HOH A . F 4 HOH 85 2085 2085 HOH HOH A . F 4 HOH 86 2086 2086 HOH HOH A . F 4 HOH 87 2087 2087 HOH HOH A . F 4 HOH 88 2088 2088 HOH HOH A . F 4 HOH 89 2089 2089 HOH HOH A . F 4 HOH 90 2090 2090 HOH HOH A . F 4 HOH 91 2091 2091 HOH HOH A . F 4 HOH 92 2092 2092 HOH HOH A . F 4 HOH 93 2093 2093 HOH HOH A . F 4 HOH 94 2094 2094 HOH HOH A . F 4 HOH 95 2095 2095 HOH HOH A . F 4 HOH 96 2096 2096 HOH HOH A . F 4 HOH 97 2097 2097 HOH HOH A . F 4 HOH 98 2098 2098 HOH HOH A . F 4 HOH 99 2099 2099 HOH HOH A . F 4 HOH 100 2100 2100 HOH HOH A . F 4 HOH 101 2101 2101 HOH HOH A . F 4 HOH 102 2102 2102 HOH HOH A . F 4 HOH 103 2103 2103 HOH HOH A . F 4 HOH 104 2104 2104 HOH HOH A . F 4 HOH 105 2105 2105 HOH HOH A . F 4 HOH 106 2106 2106 HOH HOH A . F 4 HOH 107 2107 2107 HOH HOH A . F 4 HOH 108 2108 2108 HOH HOH A . F 4 HOH 109 2109 2109 HOH HOH A . F 4 HOH 110 2110 2110 HOH HOH A . F 4 HOH 111 2111 2111 HOH HOH A . F 4 HOH 112 2112 2112 HOH HOH A . F 4 HOH 113 2113 2113 HOH HOH A . F 4 HOH 114 2114 2114 HOH HOH A . F 4 HOH 115 2115 2115 HOH HOH A . F 4 HOH 116 2116 2116 HOH HOH A . F 4 HOH 117 2117 2117 HOH HOH A . F 4 HOH 118 2118 2118 HOH HOH A . F 4 HOH 119 2119 2119 HOH HOH A . F 4 HOH 120 2120 2120 HOH HOH A . F 4 HOH 121 2121 2121 HOH HOH A . F 4 HOH 122 2122 2122 HOH HOH A . F 4 HOH 123 2123 2123 HOH HOH A . F 4 HOH 124 2124 2124 HOH HOH A . F 4 HOH 125 2125 2125 HOH HOH A . F 4 HOH 126 2126 2126 HOH HOH A . F 4 HOH 127 2127 2127 HOH HOH A . F 4 HOH 128 2128 2128 HOH HOH A . F 4 HOH 129 2129 2129 HOH HOH A . F 4 HOH 130 2130 2130 HOH HOH A . F 4 HOH 131 2131 2131 HOH HOH A . F 4 HOH 132 2132 2132 HOH HOH A . F 4 HOH 133 2133 2133 HOH HOH A . F 4 HOH 134 2134 2134 HOH HOH A . F 4 HOH 135 2135 2135 HOH HOH A . F 4 HOH 136 2136 2136 HOH HOH A . F 4 HOH 137 2137 2137 HOH HOH A . F 4 HOH 138 2138 2138 HOH HOH A . F 4 HOH 139 2139 2139 HOH HOH A . F 4 HOH 140 2140 2140 HOH HOH A . F 4 HOH 141 2141 2141 HOH HOH A . F 4 HOH 142 2142 2142 HOH HOH A . F 4 HOH 143 2143 2143 HOH HOH A . F 4 HOH 144 2144 2144 HOH HOH A . F 4 HOH 145 2145 2145 HOH HOH A . F 4 HOH 146 2146 2146 HOH HOH A . F 4 HOH 147 2147 2147 HOH HOH A . F 4 HOH 148 2148 2148 HOH HOH A . F 4 HOH 149 2149 2149 HOH HOH A . F 4 HOH 150 2150 2150 HOH HOH A . F 4 HOH 151 2151 2151 HOH HOH A . F 4 HOH 152 2152 2152 HOH HOH A . F 4 HOH 153 2153 2153 HOH HOH A . F 4 HOH 154 2154 2154 HOH HOH A . F 4 HOH 155 2155 2155 HOH HOH A . F 4 HOH 156 2156 2156 HOH HOH A . F 4 HOH 157 2157 2157 HOH HOH A . F 4 HOH 158 2158 2158 HOH HOH A . F 4 HOH 159 2159 2159 HOH HOH A . F 4 HOH 160 2160 2160 HOH HOH A . F 4 HOH 161 2161 2161 HOH HOH A . F 4 HOH 162 2162 2162 HOH HOH A . F 4 HOH 163 2163 2163 HOH HOH A . F 4 HOH 164 2164 2164 HOH HOH A . F 4 HOH 165 2165 2165 HOH HOH A . F 4 HOH 166 2166 2166 HOH HOH A . F 4 HOH 167 2167 2167 HOH HOH A . F 4 HOH 168 2168 2168 HOH HOH A . F 4 HOH 169 2169 2169 HOH HOH A . F 4 HOH 170 2170 2170 HOH HOH A . F 4 HOH 171 2171 2171 HOH HOH A . F 4 HOH 172 2172 2172 HOH HOH A . F 4 HOH 173 2173 2173 HOH HOH A . F 4 HOH 174 2174 2174 HOH HOH A . F 4 HOH 175 2175 2175 HOH HOH A . F 4 HOH 176 2176 2176 HOH HOH A . F 4 HOH 177 2177 2177 HOH HOH A . F 4 HOH 178 2178 2178 HOH HOH A . F 4 HOH 179 2179 2179 HOH HOH A . F 4 HOH 180 2180 2180 HOH HOH A . F 4 HOH 181 2181 2181 HOH HOH A . F 4 HOH 182 2182 2182 HOH HOH A . F 4 HOH 183 2183 2183 HOH HOH A . F 4 HOH 184 2184 2184 HOH HOH A . F 4 HOH 185 2185 2185 HOH HOH A . F 4 HOH 186 2186 2186 HOH HOH A . F 4 HOH 187 2187 2187 HOH HOH A . F 4 HOH 188 2188 2188 HOH HOH A . F 4 HOH 189 2189 2189 HOH HOH A . F 4 HOH 190 2190 2190 HOH HOH A . F 4 HOH 191 2191 2191 HOH HOH A . F 4 HOH 192 2192 2192 HOH HOH A . F 4 HOH 193 2193 2193 HOH HOH A . F 4 HOH 194 2194 2194 HOH HOH A . F 4 HOH 195 2195 2195 HOH HOH A . F 4 HOH 196 2196 2196 HOH HOH A . F 4 HOH 197 2197 2197 HOH HOH A . F 4 HOH 198 2198 2198 HOH HOH A . F 4 HOH 199 2199 2199 HOH HOH A . F 4 HOH 200 2200 2200 HOH HOH A . F 4 HOH 201 2201 2201 HOH HOH A . F 4 HOH 202 2202 2202 HOH HOH A . F 4 HOH 203 2203 2203 HOH HOH A . F 4 HOH 204 2204 2204 HOH HOH A . F 4 HOH 205 2205 2205 HOH HOH A . F 4 HOH 206 2206 2206 HOH HOH A . F 4 HOH 207 2207 2207 HOH HOH A . F 4 HOH 208 2208 2208 HOH HOH A . F 4 HOH 209 2209 2209 HOH HOH A . F 4 HOH 210 2210 2210 HOH HOH A . F 4 HOH 211 2211 2211 HOH HOH A . F 4 HOH 212 2212 2212 HOH HOH A . F 4 HOH 213 2213 2213 HOH HOH A . F 4 HOH 214 2214 2214 HOH HOH A . F 4 HOH 215 2215 2215 HOH HOH A . F 4 HOH 216 2216 2216 HOH HOH A . F 4 HOH 217 2217 2217 HOH HOH A . F 4 HOH 218 2218 2218 HOH HOH A . F 4 HOH 219 2219 2219 HOH HOH A . F 4 HOH 220 2220 2220 HOH HOH A . F 4 HOH 221 2221 2221 HOH HOH A . F 4 HOH 222 2222 2222 HOH HOH A . F 4 HOH 223 2223 2223 HOH HOH A . F 4 HOH 224 2224 2224 HOH HOH A . F 4 HOH 225 2225 2225 HOH HOH A . F 4 HOH 226 2226 2226 HOH HOH A . F 4 HOH 227 2227 2227 HOH HOH A . F 4 HOH 228 2228 2228 HOH HOH A . F 4 HOH 229 2229 2229 HOH HOH A . F 4 HOH 230 2230 2230 HOH HOH A . F 4 HOH 231 2231 2231 HOH HOH A . F 4 HOH 232 2232 2232 HOH HOH A . F 4 HOH 233 2233 2233 HOH HOH A . F 4 HOH 234 2234 2234 HOH HOH A . F 4 HOH 235 2235 2235 HOH HOH A . F 4 HOH 236 2236 2236 HOH HOH A . F 4 HOH 237 2237 2237 HOH HOH A . F 4 HOH 238 2238 2238 HOH HOH A . F 4 HOH 239 2239 2239 HOH HOH A . F 4 HOH 240 2240 2240 HOH HOH A . F 4 HOH 241 2241 2241 HOH HOH A . F 4 HOH 242 2242 2242 HOH HOH A . F 4 HOH 243 2243 2243 HOH HOH A . F 4 HOH 244 2244 2244 HOH HOH A . F 4 HOH 245 2245 2245 HOH HOH A . F 4 HOH 246 2246 2246 HOH HOH A . F 4 HOH 247 2247 2247 HOH HOH A . F 4 HOH 248 2248 2248 HOH HOH A . F 4 HOH 249 2249 2249 HOH HOH A . F 4 HOH 250 2250 2250 HOH HOH A . F 4 HOH 251 2251 2251 HOH HOH A . F 4 HOH 252 2252 2252 HOH HOH A . F 4 HOH 253 2253 2253 HOH HOH A . F 4 HOH 254 2254 2254 HOH HOH A . F 4 HOH 255 2255 2255 HOH HOH A . F 4 HOH 256 2256 2256 HOH HOH A . F 4 HOH 257 2257 2257 HOH HOH A . F 4 HOH 258 2258 2258 HOH HOH A . F 4 HOH 259 2259 2259 HOH HOH A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.0.36 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 ACORN phasing . ? 4 # _cell.entry_id 1EB6 _cell.length_a 38.430 _cell.length_b 34.764 _cell.length_c 60.276 _cell.angle_alpha 90.00 _cell.angle_beta 106.03 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1EB6 _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 # _exptl.entry_id 1EB6 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.0 _exptl_crystal.density_percent_sol 39 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.50 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '1.8M NA,K PHOSPHATE, 0.1M HEPES PH 7.5' # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.933 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-2' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-2 _diffrn_source.pdbx_wavelength 0.933 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1EB6 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 30.000 _reflns.d_resolution_high 1.000 _reflns.number_obs 82199 _reflns.number_all ? _reflns.percent_possible_obs 99.6 _reflns.pdbx_Rmerge_I_obs 0.05200 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 23.0000 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.500 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.00 _reflns_shell.d_res_low 1.02 _reflns_shell.percent_possible_all 99.8 _reflns_shell.Rmerge_I_obs 0.24000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.000 _reflns_shell.pdbx_redundancy 3.30 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1EB6 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 78791 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 57.73 _refine.ls_d_res_high 1.00 _refine.ls_percent_reflns_obs 99.6 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.104 _refine.ls_R_factor_R_free 0.126 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 3.000 _refine.ls_number_reflns_R_free 2439 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.986 _refine.correlation_coeff_Fo_to_Fc_free 0.979 _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'BABINET MODEL PLUS MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'DIRECT METHODS' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.017 _refine.pdbx_overall_ESU_R_Free 0.019 _refine.overall_SU_ML 0.006 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 0.220 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1335 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 13 _refine_hist.number_atoms_solvent 259 _refine_hist.number_atoms_total 1607 _refine_hist.d_res_high 1.00 _refine_hist.d_res_low 57.73 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.018 0.021 ? 1429 'X-RAY DIFFRACTION' ? r_bond_other_d 0.003 0.020 ? 1149 'X-RAY DIFFRACTION' ? r_angle_refined_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_other_deg 2.399 1.967 ? 1943 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 4.152 3.000 ? 2737 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_chiral_restr 0.146 0.200 ? 209 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.011 0.020 ? 1611 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.008 0.020 ? 256 'X-RAY DIFFRACTION' ? r_nbd_refined 0.523 0.300 ? 372 'X-RAY DIFFRACTION' ? r_nbd_other 0.330 0.300 ? 1214 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other 0.978 0.500 ? 21 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.184 0.500 ? 193 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.188 0.300 ? 5 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.140 0.300 ? 27 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.227 0.500 ? 34 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.663 1.500 ? 884 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.505 2.000 ? 1426 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 3.588 3.000 ? 539 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 5.038 4.500 ? 504 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.00 _refine_ls_shell.d_res_low 1.03 _refine_ls_shell.number_reflns_R_work 5780 _refine_ls_shell.R_factor_R_work 0.1990 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.2000 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 186 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _database_PDB_matrix.entry_id 1EB6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1EB6 _struct.title 'Deuterolysin from Aspergillus oryzae' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1EB6 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'METALLOPROTEINASE, ZINC, NEUTRAL PROTEASE II, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NPII_ASPOR _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P46076 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1EB6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 177 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P46076 _struct_ref_seq.db_align_beg 176 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 352 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 177 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 8 ? GLY A 35 ? GLY A 8 GLY A 35 1 ? 28 HELX_P HELX_P2 2 ASP A 36 ? LYS A 45 ? ASP A 36 LYS A 45 1 ? 10 HELX_P HELX_P3 3 ASP A 48 ? GLY A 67 ? ASP A 48 GLY A 67 1 ? 20 HELX_P HELX_P4 4 PRO A 95 ? LYS A 97 ? PRO A 95 LYS A 97 5 ? 3 HELX_P HELX_P5 5 CYS A 103 ? LEU A 110 ? CYS A 103 LEU A 110 1 ? 8 HELX_P HELX_P6 6 ASP A 121 ? HIS A 132 ? ASP A 121 HIS A 132 1 ? 12 HELX_P HELX_P7 7 GLY A 147 ? GLN A 153 ? GLY A 147 GLN A 153 1 ? 7 HELX_P HELX_P8 8 SER A 155 ? ASN A 161 ? SER A 155 ASN A 161 1 ? 7 HELX_P HELX_P9 9 ASN A 162 ? LYS A 176 ? ASN A 162 LYS A 176 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 78 SG ? ? A CYS 6 A CYS 78 1_555 ? ? ? ? ? ? ? 1.985 ? ? disulf2 disulf ? ? A CYS 85 SG ? ? ? 1_555 A CYS 103 SG ? ? A CYS 85 A CYS 103 1_555 ? ? ? ? ? ? ? 2.044 ? ? disulf3 disulf ? ? A CYS 117 SG A ? ? 1_555 A CYS 177 SG ? ? A CYS 117 A CYS 177 1_555 ? ? ? ? ? ? ? 2.096 ? ? disulf4 disulf ? ? A CYS 117 SG B ? ? 1_555 A CYS 177 SG ? ? A CYS 117 A CYS 177 1_555 ? ? ? ? ? ? ? 2.063 ? ? covale1 covale none ? A ASP 9 OD2 ? ? ? 1_555 C EDO . O2 B ? A ASP 9 A EDO 1178 1_555 ? ? ? ? ? ? ? 1.786 ? ? metalc1 metalc ? ? A HIS 128 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 128 A ZN 178 1_555 ? ? ? ? ? ? ? 2.055 ? ? metalc2 metalc ? ? A HIS 132 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 132 A ZN 178 1_555 ? ? ? ? ? ? ? 2.080 ? ? metalc3 metalc ? ? A ASP 143 OD1 ? ? ? 1_555 B ZN . ZN ? ? A ASP 143 A ZN 178 1_555 ? ? ? ? ? ? ? 2.151 ? ? metalc4 metalc ? ? A ASP 143 OD2 ? ? ? 1_555 B ZN . ZN ? ? A ASP 143 A ZN 178 1_555 ? ? ? ? ? ? ? 2.355 ? ? metalc5 metalc ? ? B ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 178 A HOH 2255 1_555 ? ? ? ? ? ? ? 2.227 ? ? metalc6 metalc ? ? B ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 178 A HOH 2256 1_555 ? ? ? ? ? ? ? 2.069 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 128 ? A HIS 128 ? 1_555 ZN ? B ZN . ? A ZN 178 ? 1_555 NE2 ? A HIS 132 ? A HIS 132 ? 1_555 99.5 ? 2 NE2 ? A HIS 128 ? A HIS 128 ? 1_555 ZN ? B ZN . ? A ZN 178 ? 1_555 OD1 ? A ASP 143 ? A ASP 143 ? 1_555 98.3 ? 3 NE2 ? A HIS 132 ? A HIS 132 ? 1_555 ZN ? B ZN . ? A ZN 178 ? 1_555 OD1 ? A ASP 143 ? A ASP 143 ? 1_555 93.7 ? 4 NE2 ? A HIS 128 ? A HIS 128 ? 1_555 ZN ? B ZN . ? A ZN 178 ? 1_555 OD2 ? A ASP 143 ? A ASP 143 ? 1_555 153.4 ? 5 NE2 ? A HIS 132 ? A HIS 132 ? 1_555 ZN ? B ZN . ? A ZN 178 ? 1_555 OD2 ? A ASP 143 ? A ASP 143 ? 1_555 92.3 ? 6 OD1 ? A ASP 143 ? A ASP 143 ? 1_555 ZN ? B ZN . ? A ZN 178 ? 1_555 OD2 ? A ASP 143 ? A ASP 143 ? 1_555 56.9 ? 7 NE2 ? A HIS 128 ? A HIS 128 ? 1_555 ZN ? B ZN . ? A ZN 178 ? 1_555 O ? F HOH . ? A HOH 2255 ? 1_555 86.2 ? 8 NE2 ? A HIS 132 ? A HIS 132 ? 1_555 ZN ? B ZN . ? A ZN 178 ? 1_555 O ? F HOH . ? A HOH 2255 ? 1_555 173.5 ? 9 OD1 ? A ASP 143 ? A ASP 143 ? 1_555 ZN ? B ZN . ? A ZN 178 ? 1_555 O ? F HOH . ? A HOH 2255 ? 1_555 88.6 ? 10 OD2 ? A ASP 143 ? A ASP 143 ? 1_555 ZN ? B ZN . ? A ZN 178 ? 1_555 O ? F HOH . ? A HOH 2255 ? 1_555 83.9 ? 11 NE2 ? A HIS 128 ? A HIS 128 ? 1_555 ZN ? B ZN . ? A ZN 178 ? 1_555 O ? F HOH . ? A HOH 2256 ? 1_555 108.3 ? 12 NE2 ? A HIS 132 ? A HIS 132 ? 1_555 ZN ? B ZN . ? A ZN 178 ? 1_555 O ? F HOH . ? A HOH 2256 ? 1_555 92.8 ? 13 OD1 ? A ASP 143 ? A ASP 143 ? 1_555 ZN ? B ZN . ? A ZN 178 ? 1_555 O ? F HOH . ? A HOH 2256 ? 1_555 151.1 ? 14 OD2 ? A ASP 143 ? A ASP 143 ? 1_555 ZN ? B ZN . ? A ZN 178 ? 1_555 O ? F HOH . ? A HOH 2256 ? 1_555 94.7 ? 15 O ? F HOH . ? A HOH 2255 ? 1_555 ZN ? B ZN . ? A ZN 178 ? 1_555 O ? F HOH . ? A HOH 2256 ? 1_555 82.3 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLN _struct_mon_prot_cis.label_seq_id 138 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLN _struct_mon_prot_cis.auth_seq_id 138 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 139 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 139 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.02 # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? parallel AA 2 3 ? parallel AA 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 GLU A 2 ? THR A 4 ? GLU A 2 THR A 4 AA 2 THR A 75 ? HIS A 77 ? THR A 75 HIS A 77 AA 3 GLU A 99 ? ASN A 102 ? GLU A 99 ASN A 102 AA 4 ALA A 91 ? LEU A 94 ? ALA A 91 LEU A 94 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N THR A 4 ? N THR A 4 O TYR A 76 ? O TYR A 76 AA 2 3 N HIS A 77 ? N HIS A 77 O ILE A 100 ? O ILE A 100 AA 3 4 N ALA A 101 ? N ALA A 101 O TYR A 92 ? O TYR A 92 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 178 ? 5 'BINDING SITE FOR RESIDUE ZN A 178' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE EDO A1178' AC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE EDO A1179' AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE EDO A1180' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 HIS A 128 ? HIS A 128 . ? 1_555 ? 2 AC1 5 HIS A 132 ? HIS A 132 . ? 1_555 ? 3 AC1 5 ASP A 143 ? ASP A 143 . ? 1_555 ? 4 AC1 5 HOH F . ? HOH A 2255 . ? 1_555 ? 5 AC1 5 HOH F . ? HOH A 2256 . ? 1_555 ? 6 AC2 6 ASP A 9 ? ASP A 9 . ? 1_555 ? 7 AC2 6 SER A 12 ? SER A 12 . ? 1_555 ? 8 AC2 6 SER A 13 ? SER A 13 . ? 1_555 ? 9 AC2 6 SER A 96 ? SER A 96 . ? 1_555 ? 10 AC2 6 HOH F . ? HOH A 2257 . ? 1_555 ? 11 AC2 6 HOH F . ? HOH A 2258 . ? 1_555 ? 12 AC3 8 HIS A 118 ? HIS A 118 . ? 1_555 ? 13 AC3 8 ALA A 119 ? ALA A 119 . ? 1_555 ? 14 AC3 8 GLN A 120 ? GLN A 120 . ? 1_555 ? 15 AC3 8 THR A 124 ? THR A 124 . ? 1_555 ? 16 AC3 8 ALA A 167 ? ALA A 167 . ? 1_555 ? 17 AC3 8 LEU A 168 ? LEU A 168 . ? 1_555 ? 18 AC3 8 ASN A 171 ? ASN A 171 . ? 1_555 ? 19 AC3 8 HOH F . ? HOH A 2238 . ? 1_555 ? 20 AC4 5 ALA A 114 ? ALA A 114 . ? 1_555 ? 21 AC4 5 ASP A 121 ? ASP A 121 . ? 1_555 ? 22 AC4 5 THR A 124 ? THR A 124 . ? 1_555 ? 23 AC4 5 ASN A 171 ? ASN A 171 . ? 1_555 ? 24 AC4 5 HOH F . ? HOH A 2259 . ? 1_555 ? # _pdbx_entry_details.entry_id 1EB6 _pdbx_entry_details.compound_details ;THERMOSTABLE METALLOPROTEASE. SHOWS HIGH ACTIVITIES FOR BASIC NUCLEAR SUBSTRATES. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 2037 ? ? O A HOH 2106 ? ? 1.90 2 1 OG A SER 19 ? C O A HOH 2042 ? ? 1.92 3 1 O A HOH 2180 ? ? O A HOH 2249 ? ? 2.08 4 1 OD2 A ASP 9 ? ? C2 A EDO 1178 ? B 2.15 5 1 O A HOH 2038 ? ? O A HOH 2039 ? ? 2.16 6 1 OE1 A GLU 86 ? ? O A HOH 2147 ? ? 2.18 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 2181 ? ? 1_555 O A HOH 2204 ? ? 1_545 2.08 2 1 OE1 A GLU 2 ? B 1_555 NZ A LYS 23 ? ? 2_757 2.11 3 1 O A HOH 2006 ? ? 1_555 O A HOH 2149 ? ? 2_647 2.19 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A ASP 48 ? ? CG A ASP 48 ? ? 1.378 1.513 -0.135 0.021 N 2 1 CB A GLU 99 ? ? CG A GLU 99 ? A 1.363 1.517 -0.154 0.019 N 3 1 CD A GLU 99 ? A OE2 A GLU 99 ? A 1.123 1.252 -0.129 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 58 ? ? CZ A ARG 58 ? ? NH1 A ARG 58 ? ? 123.30 120.30 3.00 0.50 N 2 1 CA A CYS 78 ? ? CB A CYS 78 ? ? SG A CYS 78 ? ? 121.67 114.20 7.47 1.10 N 3 1 CA A GLN 138 ? ? CB A GLN 138 ? ? CG A GLN 138 ? A 129.39 113.40 15.99 2.20 N 4 1 CB A TYR 146 ? B CA A TYR 146 ? ? C A TYR 146 ? ? 96.28 110.40 -14.12 2.00 N 5 1 CB A TYR 146 ? A CG A TYR 146 ? A CD2 A TYR 146 ? A 124.89 121.00 3.89 0.60 N 6 1 CB A TYR 146 ? A CG A TYR 146 ? A CD1 A TYR 146 ? A 117.39 121.00 -3.61 0.60 N 7 1 CA A CYS 177 ? ? CB A CYS 177 ? ? SG A CYS 177 ? ? 128.76 114.20 14.56 1.10 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id HIS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 118 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 73.14 _pdbx_validate_torsion.psi -1.27 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 2006 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.20 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 PHE N N N N 240 PHE CA C N S 241 PHE C C N N 242 PHE O O N N 243 PHE CB C N N 244 PHE CG C Y N 245 PHE CD1 C Y N 246 PHE CD2 C Y N 247 PHE CE1 C Y N 248 PHE CE2 C Y N 249 PHE CZ C Y N 250 PHE OXT O N N 251 PHE H H N N 252 PHE H2 H N N 253 PHE HA H N N 254 PHE HB2 H N N 255 PHE HB3 H N N 256 PHE HD1 H N N 257 PHE HD2 H N N 258 PHE HE1 H N N 259 PHE HE2 H N N 260 PHE HZ H N N 261 PHE HXT H N N 262 PRO N N N N 263 PRO CA C N S 264 PRO C C N N 265 PRO O O N N 266 PRO CB C N N 267 PRO CG C N N 268 PRO CD C N N 269 PRO OXT O N N 270 PRO H H N N 271 PRO HA H N N 272 PRO HB2 H N N 273 PRO HB3 H N N 274 PRO HG2 H N N 275 PRO HG3 H N N 276 PRO HD2 H N N 277 PRO HD3 H N N 278 PRO HXT H N N 279 SER N N N N 280 SER CA C N S 281 SER C C N N 282 SER O O N N 283 SER CB C N N 284 SER OG O N N 285 SER OXT O N N 286 SER H H N N 287 SER H2 H N N 288 SER HA H N N 289 SER HB2 H N N 290 SER HB3 H N N 291 SER HG H N N 292 SER HXT H N N 293 THR N N N N 294 THR CA C N S 295 THR C C N N 296 THR O O N N 297 THR CB C N R 298 THR OG1 O N N 299 THR CG2 C N N 300 THR OXT O N N 301 THR H H N N 302 THR H2 H N N 303 THR HA H N N 304 THR HB H N N 305 THR HG1 H N N 306 THR HG21 H N N 307 THR HG22 H N N 308 THR HG23 H N N 309 THR HXT H N N 310 TYR N N N N 311 TYR CA C N S 312 TYR C C N N 313 TYR O O N N 314 TYR CB C N N 315 TYR CG C Y N 316 TYR CD1 C Y N 317 TYR CD2 C Y N 318 TYR CE1 C Y N 319 TYR CE2 C Y N 320 TYR CZ C Y N 321 TYR OH O N N 322 TYR OXT O N N 323 TYR H H N N 324 TYR H2 H N N 325 TYR HA H N N 326 TYR HB2 H N N 327 TYR HB3 H N N 328 TYR HD1 H N N 329 TYR HD2 H N N 330 TYR HE1 H N N 331 TYR HE2 H N N 332 TYR HH H N N 333 TYR HXT H N N 334 VAL N N N N 335 VAL CA C N S 336 VAL C C N N 337 VAL O O N N 338 VAL CB C N N 339 VAL CG1 C N N 340 VAL CG2 C N N 341 VAL OXT O N N 342 VAL H H N N 343 VAL H2 H N N 344 VAL HA H N N 345 VAL HB H N N 346 VAL HG11 H N N 347 VAL HG12 H N N 348 VAL HG13 H N N 349 VAL HG21 H N N 350 VAL HG22 H N N 351 VAL HG23 H N N 352 VAL HXT H N N 353 ZN ZN ZN N N 354 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 PHE N CA sing N N 227 PHE N H sing N N 228 PHE N H2 sing N N 229 PHE CA C sing N N 230 PHE CA CB sing N N 231 PHE CA HA sing N N 232 PHE C O doub N N 233 PHE C OXT sing N N 234 PHE CB CG sing N N 235 PHE CB HB2 sing N N 236 PHE CB HB3 sing N N 237 PHE CG CD1 doub Y N 238 PHE CG CD2 sing Y N 239 PHE CD1 CE1 sing Y N 240 PHE CD1 HD1 sing N N 241 PHE CD2 CE2 doub Y N 242 PHE CD2 HD2 sing N N 243 PHE CE1 CZ doub Y N 244 PHE CE1 HE1 sing N N 245 PHE CE2 CZ sing Y N 246 PHE CE2 HE2 sing N N 247 PHE CZ HZ sing N N 248 PHE OXT HXT sing N N 249 PRO N CA sing N N 250 PRO N CD sing N N 251 PRO N H sing N N 252 PRO CA C sing N N 253 PRO CA CB sing N N 254 PRO CA HA sing N N 255 PRO C O doub N N 256 PRO C OXT sing N N 257 PRO CB CG sing N N 258 PRO CB HB2 sing N N 259 PRO CB HB3 sing N N 260 PRO CG CD sing N N 261 PRO CG HG2 sing N N 262 PRO CG HG3 sing N N 263 PRO CD HD2 sing N N 264 PRO CD HD3 sing N N 265 PRO OXT HXT sing N N 266 SER N CA sing N N 267 SER N H sing N N 268 SER N H2 sing N N 269 SER CA C sing N N 270 SER CA CB sing N N 271 SER CA HA sing N N 272 SER C O doub N N 273 SER C OXT sing N N 274 SER CB OG sing N N 275 SER CB HB2 sing N N 276 SER CB HB3 sing N N 277 SER OG HG sing N N 278 SER OXT HXT sing N N 279 THR N CA sing N N 280 THR N H sing N N 281 THR N H2 sing N N 282 THR CA C sing N N 283 THR CA CB sing N N 284 THR CA HA sing N N 285 THR C O doub N N 286 THR C OXT sing N N 287 THR CB OG1 sing N N 288 THR CB CG2 sing N N 289 THR CB HB sing N N 290 THR OG1 HG1 sing N N 291 THR CG2 HG21 sing N N 292 THR CG2 HG22 sing N N 293 THR CG2 HG23 sing N N 294 THR OXT HXT sing N N 295 TYR N CA sing N N 296 TYR N H sing N N 297 TYR N H2 sing N N 298 TYR CA C sing N N 299 TYR CA CB sing N N 300 TYR CA HA sing N N 301 TYR C O doub N N 302 TYR C OXT sing N N 303 TYR CB CG sing N N 304 TYR CB HB2 sing N N 305 TYR CB HB3 sing N N 306 TYR CG CD1 doub Y N 307 TYR CG CD2 sing Y N 308 TYR CD1 CE1 sing Y N 309 TYR CD1 HD1 sing N N 310 TYR CD2 CE2 doub Y N 311 TYR CD2 HD2 sing N N 312 TYR CE1 CZ doub Y N 313 TYR CE1 HE1 sing N N 314 TYR CE2 CZ sing Y N 315 TYR CE2 HE2 sing N N 316 TYR CZ OH sing N N 317 TYR OH HH sing N N 318 TYR OXT HXT sing N N 319 VAL N CA sing N N 320 VAL N H sing N N 321 VAL N H2 sing N N 322 VAL CA C sing N N 323 VAL CA CB sing N N 324 VAL CA HA sing N N 325 VAL C O doub N N 326 VAL C OXT sing N N 327 VAL CB CG1 sing N N 328 VAL CB CG2 sing N N 329 VAL CB HB sing N N 330 VAL CG1 HG11 sing N N 331 VAL CG1 HG12 sing N N 332 VAL CG1 HG13 sing N N 333 VAL CG2 HG21 sing N N 334 VAL CG2 HG22 sing N N 335 VAL CG2 HG23 sing N N 336 VAL OXT HXT sing N N 337 # _atom_sites.entry_id 1EB6 _atom_sites.fract_transf_matrix[1][1] 0.026021 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.007476 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.028765 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017261 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_