data_1ED7 # _entry.id 1ED7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ED7 pdb_00001ed7 10.2210/pdb1ed7/pdb RCSB RCSB010466 ? ? WWPDB D_1000010466 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-05-24 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ED7 _pdbx_database_status.recvd_initial_deposition_date 2000-01-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ikegami, T.' 1 'Okada, T.' 2 'Hashimoto, M.' 3 'Seino, S.' 4 'Watanabe, T.' 5 'Shirakawa, M.' 6 # _citation.id primary _citation.title 'Solution structure of the chitin-binding domain of Bacillus circulans WL-12 chitinase A1.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 275 _citation.page_first 13654 _citation.page_last 13661 _citation.year 2000 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10788483 _citation.pdbx_database_id_DOI 10.1074/jbc.275.18.13654 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ikegami, T.' 1 ? primary 'Okada, T.' 2 ? primary 'Hashimoto, M.' 3 ? primary 'Seino, S.' 4 ? primary 'Watanabe, T.' 5 ? primary 'Shirakawa, M.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'CHITINASE A1' _entity.formula_weight 5038.625 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.2.1.14 _entity.pdbx_mutation ? _entity.pdbx_fragment 'CHITIN-BINDING DOMAIN' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name '(CHBD-CHIA1)' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AWQVNTAYTAGQLVTYNGKTYKCLQPHTSLAGWEPSNVPALWQLQ _entity_poly.pdbx_seq_one_letter_code_can AWQVNTAYTAGQLVTYNGKTYKCLQPHTSLAGWEPSNVPALWQLQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 TRP n 1 3 GLN n 1 4 VAL n 1 5 ASN n 1 6 THR n 1 7 ALA n 1 8 TYR n 1 9 THR n 1 10 ALA n 1 11 GLY n 1 12 GLN n 1 13 LEU n 1 14 VAL n 1 15 THR n 1 16 TYR n 1 17 ASN n 1 18 GLY n 1 19 LYS n 1 20 THR n 1 21 TYR n 1 22 LYS n 1 23 CYS n 1 24 LEU n 1 25 GLN n 1 26 PRO n 1 27 HIS n 1 28 THR n 1 29 SER n 1 30 LEU n 1 31 ALA n 1 32 GLY n 1 33 TRP n 1 34 GLU n 1 35 PRO n 1 36 SER n 1 37 ASN n 1 38 VAL n 1 39 PRO n 1 40 ALA n 1 41 LEU n 1 42 TRP n 1 43 GLN n 1 44 LEU n 1 45 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain WL-12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus circulans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1397 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET3A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 655 655 ALA ALA A . n A 1 2 TRP 2 656 656 TRP TRP A . n A 1 3 GLN 3 657 657 GLN GLN A . n A 1 4 VAL 4 658 658 VAL VAL A . n A 1 5 ASN 5 659 659 ASN ASN A . n A 1 6 THR 6 660 660 THR THR A . n A 1 7 ALA 7 661 661 ALA ALA A . n A 1 8 TYR 8 662 662 TYR TYR A . n A 1 9 THR 9 663 663 THR THR A . n A 1 10 ALA 10 664 664 ALA ALA A . n A 1 11 GLY 11 665 665 GLY GLY A . n A 1 12 GLN 12 666 666 GLN GLN A . n A 1 13 LEU 13 667 667 LEU LEU A . n A 1 14 VAL 14 668 668 VAL VAL A . n A 1 15 THR 15 669 669 THR THR A . n A 1 16 TYR 16 670 670 TYR TYR A . n A 1 17 ASN 17 671 671 ASN ASN A . n A 1 18 GLY 18 672 672 GLY GLY A . n A 1 19 LYS 19 673 673 LYS LYS A . n A 1 20 THR 20 674 674 THR THR A . n A 1 21 TYR 21 675 675 TYR TYR A . n A 1 22 LYS 22 676 676 LYS LYS A . n A 1 23 CYS 23 677 677 CYS CYS A . n A 1 24 LEU 24 678 678 LEU LEU A . n A 1 25 GLN 25 679 679 GLN GLN A . n A 1 26 PRO 26 680 680 PRO PRO A . n A 1 27 HIS 27 681 681 HIS HIS A . n A 1 28 THR 28 682 682 THR THR A . n A 1 29 SER 29 683 683 SER SER A . n A 1 30 LEU 30 684 684 LEU LEU A . n A 1 31 ALA 31 685 685 ALA ALA A . n A 1 32 GLY 32 686 686 GLY GLY A . n A 1 33 TRP 33 687 687 TRP TRP A . n A 1 34 GLU 34 688 688 GLU GLU A . n A 1 35 PRO 35 689 689 PRO PRO A . n A 1 36 SER 36 690 690 SER SER A . n A 1 37 ASN 37 691 691 ASN ASN A . n A 1 38 VAL 38 692 692 VAL VAL A . n A 1 39 PRO 39 693 693 PRO PRO A . n A 1 40 ALA 40 694 694 ALA ALA A . n A 1 41 LEU 41 695 695 LEU LEU A . n A 1 42 TRP 42 696 696 TRP TRP A . n A 1 43 GLN 43 697 697 GLN GLN A . n A 1 44 LEU 44 698 698 LEU LEU A . n A 1 45 GLN 45 699 699 GLN GLN A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 699 ? O ? A GLN 45 O 2 2 Y 1 A GLN 699 ? O ? A GLN 45 O 3 3 Y 1 A GLN 699 ? O ? A GLN 45 O 4 4 Y 1 A GLN 699 ? O ? A GLN 45 O 5 5 Y 1 A GLN 699 ? O ? A GLN 45 O 6 6 Y 1 A GLN 699 ? O ? A GLN 45 O 7 7 Y 1 A GLN 699 ? O ? A GLN 45 O 8 8 Y 1 A GLN 699 ? O ? A GLN 45 O 9 9 Y 1 A GLN 699 ? O ? A GLN 45 O 10 10 Y 1 A GLN 699 ? O ? A GLN 45 O 11 11 Y 1 A GLN 699 ? O ? A GLN 45 O 12 12 Y 1 A GLN 699 ? O ? A GLN 45 O 13 13 Y 1 A GLN 699 ? O ? A GLN 45 O 14 14 Y 1 A GLN 699 ? O ? A GLN 45 O 15 15 Y 1 A GLN 699 ? O ? A GLN 45 O 16 16 Y 1 A GLN 699 ? O ? A GLN 45 O 17 17 Y 1 A GLN 699 ? O ? A GLN 45 O 18 18 Y 1 A GLN 699 ? O ? A GLN 45 O 19 19 Y 1 A GLN 699 ? O ? A GLN 45 O 20 20 Y 1 A GLN 699 ? O ? A GLN 45 O 21 21 Y 1 A GLN 699 ? O ? A GLN 45 O 22 22 Y 1 A GLN 699 ? O ? A GLN 45 O 23 23 Y 1 A GLN 699 ? O ? A GLN 45 O 24 24 Y 1 A GLN 699 ? O ? A GLN 45 O 25 25 Y 1 A GLN 699 ? O ? A GLN 45 O 26 26 Y 1 A GLN 699 ? O ? A GLN 45 O 27 27 Y 1 A GLN 699 ? O ? A GLN 45 O 28 28 Y 1 A GLN 699 ? O ? A GLN 45 O 29 29 Y 1 A GLN 699 ? O ? A GLN 45 O 30 30 Y 1 A GLN 699 ? O ? A GLN 45 O # _cell.entry_id 1ED7 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ED7 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1ED7 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1ED7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1ED7 _struct.title 'SOLUTION STRUCTURE OF THE CHITIN-BINDING DOMAIN OF BACILLUS CIRCULANS WL-12 CHITINASE A1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ED7 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'twisted beta-sandwich, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CHIA1_BACCI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P20533 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ED7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 45 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P20533 _struct_ref_seq.db_align_beg 655 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 699 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 655 _struct_ref_seq.pdbx_auth_seq_align_end 699 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 6 ? TYR A 8 ? THR A 660 TYR A 662 A 2 HIS A 27 ? SER A 29 ? HIS A 681 SER A 683 B 1 GLN A 12 ? TYR A 16 ? GLN A 666 TYR A 670 B 2 LYS A 19 ? CYS A 23 ? LYS A 673 CYS A 677 B 3 TRP A 42 ? LEU A 44 ? TRP A 696 LEU A 698 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 8 ? N TYR A 662 O HIS A 27 ? O HIS A 681 B 1 2 O TYR A 16 ? O TYR A 670 N LYS A 19 ? N LYS A 673 B 2 3 O LYS A 22 ? O LYS A 676 N GLN A 43 ? N GLN A 697 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A PRO 689 ? ? HG A SER 690 ? ? 1.50 2 5 O A PRO 689 ? ? HG A SER 690 ? ? 1.49 3 7 O A PRO 689 ? ? HG A SER 690 ? ? 1.50 4 8 O A PRO 689 ? ? HG A SER 690 ? ? 1.55 5 12 O A PRO 680 ? ? HD1 A HIS 681 ? ? 1.55 6 13 H A GLY 665 ? ? O A CYS 677 ? ? 1.60 7 20 H A GLY 665 ? ? O A CYS 677 ? ? 1.58 8 26 H A GLY 665 ? ? O A CYS 677 ? ? 1.59 9 30 O A LEU 684 ? ? H A GLY 686 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 670 ? ? -97.72 -156.70 2 1 ASN A 671 ? ? -47.82 90.87 3 1 ALA A 685 ? ? -63.40 71.60 4 1 TRP A 687 ? ? -88.55 36.27 5 2 ASN A 671 ? ? 40.67 88.43 6 2 ALA A 685 ? ? -64.29 74.75 7 2 TRP A 687 ? ? -86.38 33.38 8 2 VAL A 692 ? ? -116.87 78.48 9 3 ALA A 664 ? ? -58.63 108.06 10 3 ASN A 671 ? ? -31.15 -35.87 11 3 PRO A 680 ? ? -61.61 99.54 12 3 ALA A 685 ? ? -60.42 78.66 13 3 TRP A 687 ? ? -89.46 37.72 14 4 ASN A 671 ? ? -32.09 -37.93 15 4 PRO A 680 ? ? -59.77 102.31 16 4 ALA A 685 ? ? -62.45 73.99 17 4 TRP A 687 ? ? -89.60 38.82 18 5 VAL A 658 ? ? -48.04 155.79 19 5 ASN A 671 ? ? -29.60 -38.42 20 5 PRO A 680 ? ? -62.32 99.36 21 5 ALA A 685 ? ? -58.26 81.43 22 5 TRP A 687 ? ? -86.57 30.48 23 5 SER A 690 ? ? 71.06 59.41 24 6 ASN A 671 ? ? 57.99 -82.21 25 6 ALA A 685 ? ? -63.69 72.16 26 6 TRP A 687 ? ? -88.64 39.34 27 6 SER A 690 ? ? 69.90 62.04 28 6 LEU A 698 ? ? -104.32 -169.99 29 7 THR A 663 ? ? -111.82 -167.47 30 7 TYR A 670 ? ? -83.30 -159.45 31 7 ASN A 671 ? ? -46.30 93.81 32 7 HIS A 681 ? ? -155.42 -156.58 33 7 ALA A 685 ? ? -64.40 74.91 34 7 TRP A 687 ? ? -85.68 30.89 35 8 ASN A 671 ? ? 42.76 82.62 36 8 ALA A 685 ? ? -60.51 77.38 37 8 TRP A 687 ? ? -87.97 32.58 38 9 ASN A 671 ? ? 57.57 -80.76 39 9 PRO A 680 ? ? -61.58 94.68 40 9 ALA A 685 ? ? -60.24 84.70 41 9 TRP A 687 ? ? -88.91 37.87 42 9 LEU A 695 ? ? -140.21 10.33 43 10 ASN A 671 ? ? 45.25 83.43 44 10 PRO A 680 ? ? -63.68 94.10 45 10 ALA A 685 ? ? -67.30 81.80 46 10 TRP A 687 ? ? -86.70 32.79 47 10 VAL A 692 ? ? -116.27 76.76 48 11 ASN A 671 ? ? -47.81 91.51 49 11 ALA A 685 ? ? -63.83 74.15 50 11 TRP A 687 ? ? -85.65 31.54 51 12 THR A 663 ? ? -100.70 -167.11 52 12 TYR A 670 ? ? -96.18 -159.52 53 12 ASN A 671 ? ? -43.72 94.17 54 12 PRO A 680 ? ? -63.38 94.22 55 12 ALA A 685 ? ? -63.39 76.09 56 12 TRP A 687 ? ? -89.82 40.24 57 12 GLN A 697 ? ? -102.02 73.40 58 13 PRO A 680 ? ? -61.76 95.46 59 13 ALA A 685 ? ? -62.56 74.06 60 13 TRP A 687 ? ? -89.07 38.91 61 13 SER A 690 ? ? 64.37 62.87 62 14 ASN A 671 ? ? 56.85 -85.76 63 14 PRO A 680 ? ? -62.50 98.62 64 14 ALA A 685 ? ? -61.65 82.53 65 14 GLN A 697 ? ? -108.77 72.01 66 15 ASN A 671 ? ? -43.93 96.76 67 15 PRO A 680 ? ? -62.99 96.07 68 15 ALA A 685 ? ? -64.51 70.67 69 15 TRP A 687 ? ? -88.86 38.64 70 16 THR A 663 ? ? -103.07 -166.98 71 16 ASN A 671 ? ? 64.31 -69.74 72 16 ALA A 685 ? ? -63.95 78.03 73 16 TRP A 687 ? ? -87.22 33.34 74 16 SER A 690 ? ? 67.06 67.57 75 17 TYR A 670 ? ? -79.73 -165.35 76 17 ASN A 671 ? ? -47.25 95.46 77 17 ALA A 685 ? ? -64.65 77.25 78 17 TRP A 687 ? ? -86.43 32.52 79 18 ASN A 671 ? ? -54.77 92.11 80 18 PRO A 680 ? ? -63.35 92.76 81 18 ALA A 685 ? ? -67.01 82.05 82 18 TRP A 687 ? ? -86.72 32.89 83 19 ASN A 671 ? ? 43.53 85.09 84 19 ALA A 685 ? ? -64.25 73.23 85 19 TRP A 687 ? ? -86.59 33.03 86 20 ASN A 671 ? ? -45.19 93.34 87 20 PRO A 680 ? ? -60.35 94.90 88 20 ALA A 685 ? ? -64.56 69.75 89 20 TRP A 687 ? ? -87.64 35.09 90 20 SER A 690 ? ? 64.16 61.54 91 21 ASN A 671 ? ? 36.87 81.80 92 21 PRO A 680 ? ? -58.04 105.72 93 21 ALA A 685 ? ? -63.15 75.51 94 21 TRP A 687 ? ? -89.09 38.19 95 22 ASN A 671 ? ? 40.69 86.75 96 22 ALA A 685 ? ? -60.25 85.63 97 22 TRP A 687 ? ? -85.75 31.88 98 22 SER A 690 ? ? 68.22 61.04 99 23 ASN A 671 ? ? 64.08 -69.83 100 23 HIS A 681 ? ? -139.10 -158.27 101 23 ALA A 685 ? ? -65.33 71.59 102 23 TRP A 687 ? ? -88.53 37.29 103 24 ASN A 671 ? ? -47.46 92.56 104 24 ALA A 685 ? ? -66.86 79.92 105 24 TRP A 687 ? ? -86.67 32.83 106 25 ASN A 671 ? ? 39.17 90.81 107 25 PRO A 680 ? ? -59.80 108.93 108 25 ALA A 685 ? ? -63.98 70.48 109 25 TRP A 687 ? ? -87.24 32.98 110 26 ASN A 671 ? ? -46.73 94.74 111 26 PRO A 680 ? ? -58.51 94.66 112 26 ALA A 685 ? ? -69.01 76.15 113 26 TRP A 687 ? ? -86.92 36.46 114 27 ASN A 659 ? ? 70.28 51.93 115 27 PRO A 680 ? ? -59.78 103.89 116 27 ALA A 685 ? ? -62.24 82.53 117 27 TRP A 687 ? ? -87.20 34.44 118 28 ASN A 671 ? ? 65.46 -71.59 119 28 ALA A 685 ? ? -64.12 70.79 120 28 TRP A 687 ? ? -89.19 38.75 121 29 ASN A 671 ? ? 41.31 84.46 122 29 PRO A 680 ? ? -64.87 93.54 123 29 ALA A 685 ? ? -65.08 67.05 124 29 TRP A 687 ? ? -86.93 34.14 125 30 ASN A 671 ? ? 44.22 81.53 126 30 ALA A 685 ? ? -64.92 64.67 127 30 TRP A 687 ? ? -87.68 37.10 128 30 VAL A 692 ? ? -119.84 78.70 # _pdbx_nmr_ensemble.entry_id 1ED7 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1ED7 _pdbx_nmr_representative.conformer_id 26 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '2.0 mM 15N-labeled ChBD-ChiA1 in 10 mM KH2PO4-K2HPO4 (pH 6.0) and 10 mM deuterated dithiothreitol (DTT)' '90% H2O/10% D2O' 2 '1.2 mM 15N-labeled ChBD-ChiA1 in 100 mM KH2PO4-K2HPO4 (pH 6.0) and 10 mM deuterated DTT' '99.8% D2O' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 310 ambient 6.0 10 ? K 2 310 ambient 6.0 100 ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 2 2 '2D NOESY' 2 1 1 3D_15N-separated_NOESY 3 1 1 HMQC-J # _pdbx_nmr_details.entry_id 1ED7 _pdbx_nmr_details.text ;This structure was determined using a uniformly 15N-labeled ChBD-ChiA1. Stereospecific assignments of the methyl groups of the leucine and valine residues were achieved with 15% fractionally 13C-labeled ChBD-ChiA1 dissolved in 99.8% D2O. ; # _pdbx_nmr_refine.entry_id 1ED7 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'The structures are based on 493 NOE-based distance, 20 hydrogen bond, and 33 dihedral angle constraints.' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 3.851 refinement Brunger 1 DYANA 1.5 'structure solution' Guentert 2 NMRPipe 1.7 processing Delaglio 3 XwinNMR 2.0 collection Bruker 4 nmrPipp 4.2.4 'data analysis' Garrett 5 MOLMOL 2.3 'data analysis' Koradi 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 CYS N N N N 31 CYS CA C N R 32 CYS C C N N 33 CYS O O N N 34 CYS CB C N N 35 CYS SG S N N 36 CYS OXT O N N 37 CYS H H N N 38 CYS H2 H N N 39 CYS HA H N N 40 CYS HB2 H N N 41 CYS HB3 H N N 42 CYS HG H N N 43 CYS HXT H N N 44 GLN N N N N 45 GLN CA C N S 46 GLN C C N N 47 GLN O O N N 48 GLN CB C N N 49 GLN CG C N N 50 GLN CD C N N 51 GLN OE1 O N N 52 GLN NE2 N N N 53 GLN OXT O N N 54 GLN H H N N 55 GLN H2 H N N 56 GLN HA H N N 57 GLN HB2 H N N 58 GLN HB3 H N N 59 GLN HG2 H N N 60 GLN HG3 H N N 61 GLN HE21 H N N 62 GLN HE22 H N N 63 GLN HXT H N N 64 GLU N N N N 65 GLU CA C N S 66 GLU C C N N 67 GLU O O N N 68 GLU CB C N N 69 GLU CG C N N 70 GLU CD C N N 71 GLU OE1 O N N 72 GLU OE2 O N N 73 GLU OXT O N N 74 GLU H H N N 75 GLU H2 H N N 76 GLU HA H N N 77 GLU HB2 H N N 78 GLU HB3 H N N 79 GLU HG2 H N N 80 GLU HG3 H N N 81 GLU HE2 H N N 82 GLU HXT H N N 83 GLY N N N N 84 GLY CA C N N 85 GLY C C N N 86 GLY O O N N 87 GLY OXT O N N 88 GLY H H N N 89 GLY H2 H N N 90 GLY HA2 H N N 91 GLY HA3 H N N 92 GLY HXT H N N 93 HIS N N N N 94 HIS CA C N S 95 HIS C C N N 96 HIS O O N N 97 HIS CB C N N 98 HIS CG C Y N 99 HIS ND1 N Y N 100 HIS CD2 C Y N 101 HIS CE1 C Y N 102 HIS NE2 N Y N 103 HIS OXT O N N 104 HIS H H N N 105 HIS H2 H N N 106 HIS HA H N N 107 HIS HB2 H N N 108 HIS HB3 H N N 109 HIS HD1 H N N 110 HIS HD2 H N N 111 HIS HE1 H N N 112 HIS HE2 H N N 113 HIS HXT H N N 114 LEU N N N N 115 LEU CA C N S 116 LEU C C N N 117 LEU O O N N 118 LEU CB C N N 119 LEU CG C N N 120 LEU CD1 C N N 121 LEU CD2 C N N 122 LEU OXT O N N 123 LEU H H N N 124 LEU H2 H N N 125 LEU HA H N N 126 LEU HB2 H N N 127 LEU HB3 H N N 128 LEU HG H N N 129 LEU HD11 H N N 130 LEU HD12 H N N 131 LEU HD13 H N N 132 LEU HD21 H N N 133 LEU HD22 H N N 134 LEU HD23 H N N 135 LEU HXT H N N 136 LYS N N N N 137 LYS CA C N S 138 LYS C C N N 139 LYS O O N N 140 LYS CB C N N 141 LYS CG C N N 142 LYS CD C N N 143 LYS CE C N N 144 LYS NZ N N N 145 LYS OXT O N N 146 LYS H H N N 147 LYS H2 H N N 148 LYS HA H N N 149 LYS HB2 H N N 150 LYS HB3 H N N 151 LYS HG2 H N N 152 LYS HG3 H N N 153 LYS HD2 H N N 154 LYS HD3 H N N 155 LYS HE2 H N N 156 LYS HE3 H N N 157 LYS HZ1 H N N 158 LYS HZ2 H N N 159 LYS HZ3 H N N 160 LYS HXT H N N 161 PRO N N N N 162 PRO CA C N S 163 PRO C C N N 164 PRO O O N N 165 PRO CB C N N 166 PRO CG C N N 167 PRO CD C N N 168 PRO OXT O N N 169 PRO H H N N 170 PRO HA H N N 171 PRO HB2 H N N 172 PRO HB3 H N N 173 PRO HG2 H N N 174 PRO HG3 H N N 175 PRO HD2 H N N 176 PRO HD3 H N N 177 PRO HXT H N N 178 SER N N N N 179 SER CA C N S 180 SER C C N N 181 SER O O N N 182 SER CB C N N 183 SER OG O N N 184 SER OXT O N N 185 SER H H N N 186 SER H2 H N N 187 SER HA H N N 188 SER HB2 H N N 189 SER HB3 H N N 190 SER HG H N N 191 SER HXT H N N 192 THR N N N N 193 THR CA C N S 194 THR C C N N 195 THR O O N N 196 THR CB C N R 197 THR OG1 O N N 198 THR CG2 C N N 199 THR OXT O N N 200 THR H H N N 201 THR H2 H N N 202 THR HA H N N 203 THR HB H N N 204 THR HG1 H N N 205 THR HG21 H N N 206 THR HG22 H N N 207 THR HG23 H N N 208 THR HXT H N N 209 TRP N N N N 210 TRP CA C N S 211 TRP C C N N 212 TRP O O N N 213 TRP CB C N N 214 TRP CG C Y N 215 TRP CD1 C Y N 216 TRP CD2 C Y N 217 TRP NE1 N Y N 218 TRP CE2 C Y N 219 TRP CE3 C Y N 220 TRP CZ2 C Y N 221 TRP CZ3 C Y N 222 TRP CH2 C Y N 223 TRP OXT O N N 224 TRP H H N N 225 TRP H2 H N N 226 TRP HA H N N 227 TRP HB2 H N N 228 TRP HB3 H N N 229 TRP HD1 H N N 230 TRP HE1 H N N 231 TRP HE3 H N N 232 TRP HZ2 H N N 233 TRP HZ3 H N N 234 TRP HH2 H N N 235 TRP HXT H N N 236 TYR N N N N 237 TYR CA C N S 238 TYR C C N N 239 TYR O O N N 240 TYR CB C N N 241 TYR CG C Y N 242 TYR CD1 C Y N 243 TYR CD2 C Y N 244 TYR CE1 C Y N 245 TYR CE2 C Y N 246 TYR CZ C Y N 247 TYR OH O N N 248 TYR OXT O N N 249 TYR H H N N 250 TYR H2 H N N 251 TYR HA H N N 252 TYR HB2 H N N 253 TYR HB3 H N N 254 TYR HD1 H N N 255 TYR HD2 H N N 256 TYR HE1 H N N 257 TYR HE2 H N N 258 TYR HH H N N 259 TYR HXT H N N 260 VAL N N N N 261 VAL CA C N S 262 VAL C C N N 263 VAL O O N N 264 VAL CB C N N 265 VAL CG1 C N N 266 VAL CG2 C N N 267 VAL OXT O N N 268 VAL H H N N 269 VAL H2 H N N 270 VAL HA H N N 271 VAL HB H N N 272 VAL HG11 H N N 273 VAL HG12 H N N 274 VAL HG13 H N N 275 VAL HG21 H N N 276 VAL HG22 H N N 277 VAL HG23 H N N 278 VAL HXT H N N 279 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 CYS N CA sing N N 29 CYS N H sing N N 30 CYS N H2 sing N N 31 CYS CA C sing N N 32 CYS CA CB sing N N 33 CYS CA HA sing N N 34 CYS C O doub N N 35 CYS C OXT sing N N 36 CYS CB SG sing N N 37 CYS CB HB2 sing N N 38 CYS CB HB3 sing N N 39 CYS SG HG sing N N 40 CYS OXT HXT sing N N 41 GLN N CA sing N N 42 GLN N H sing N N 43 GLN N H2 sing N N 44 GLN CA C sing N N 45 GLN CA CB sing N N 46 GLN CA HA sing N N 47 GLN C O doub N N 48 GLN C OXT sing N N 49 GLN CB CG sing N N 50 GLN CB HB2 sing N N 51 GLN CB HB3 sing N N 52 GLN CG CD sing N N 53 GLN CG HG2 sing N N 54 GLN CG HG3 sing N N 55 GLN CD OE1 doub N N 56 GLN CD NE2 sing N N 57 GLN NE2 HE21 sing N N 58 GLN NE2 HE22 sing N N 59 GLN OXT HXT sing N N 60 GLU N CA sing N N 61 GLU N H sing N N 62 GLU N H2 sing N N 63 GLU CA C sing N N 64 GLU CA CB sing N N 65 GLU CA HA sing N N 66 GLU C O doub N N 67 GLU C OXT sing N N 68 GLU CB CG sing N N 69 GLU CB HB2 sing N N 70 GLU CB HB3 sing N N 71 GLU CG CD sing N N 72 GLU CG HG2 sing N N 73 GLU CG HG3 sing N N 74 GLU CD OE1 doub N N 75 GLU CD OE2 sing N N 76 GLU OE2 HE2 sing N N 77 GLU OXT HXT sing N N 78 GLY N CA sing N N 79 GLY N H sing N N 80 GLY N H2 sing N N 81 GLY CA C sing N N 82 GLY CA HA2 sing N N 83 GLY CA HA3 sing N N 84 GLY C O doub N N 85 GLY C OXT sing N N 86 GLY OXT HXT sing N N 87 HIS N CA sing N N 88 HIS N H sing N N 89 HIS N H2 sing N N 90 HIS CA C sing N N 91 HIS CA CB sing N N 92 HIS CA HA sing N N 93 HIS C O doub N N 94 HIS C OXT sing N N 95 HIS CB CG sing N N 96 HIS CB HB2 sing N N 97 HIS CB HB3 sing N N 98 HIS CG ND1 sing Y N 99 HIS CG CD2 doub Y N 100 HIS ND1 CE1 doub Y N 101 HIS ND1 HD1 sing N N 102 HIS CD2 NE2 sing Y N 103 HIS CD2 HD2 sing N N 104 HIS CE1 NE2 sing Y N 105 HIS CE1 HE1 sing N N 106 HIS NE2 HE2 sing N N 107 HIS OXT HXT sing N N 108 LEU N CA sing N N 109 LEU N H sing N N 110 LEU N H2 sing N N 111 LEU CA C sing N N 112 LEU CA CB sing N N 113 LEU CA HA sing N N 114 LEU C O doub N N 115 LEU C OXT sing N N 116 LEU CB CG sing N N 117 LEU CB HB2 sing N N 118 LEU CB HB3 sing N N 119 LEU CG CD1 sing N N 120 LEU CG CD2 sing N N 121 LEU CG HG sing N N 122 LEU CD1 HD11 sing N N 123 LEU CD1 HD12 sing N N 124 LEU CD1 HD13 sing N N 125 LEU CD2 HD21 sing N N 126 LEU CD2 HD22 sing N N 127 LEU CD2 HD23 sing N N 128 LEU OXT HXT sing N N 129 LYS N CA sing N N 130 LYS N H sing N N 131 LYS N H2 sing N N 132 LYS CA C sing N N 133 LYS CA CB sing N N 134 LYS CA HA sing N N 135 LYS C O doub N N 136 LYS C OXT sing N N 137 LYS CB CG sing N N 138 LYS CB HB2 sing N N 139 LYS CB HB3 sing N N 140 LYS CG CD sing N N 141 LYS CG HG2 sing N N 142 LYS CG HG3 sing N N 143 LYS CD CE sing N N 144 LYS CD HD2 sing N N 145 LYS CD HD3 sing N N 146 LYS CE NZ sing N N 147 LYS CE HE2 sing N N 148 LYS CE HE3 sing N N 149 LYS NZ HZ1 sing N N 150 LYS NZ HZ2 sing N N 151 LYS NZ HZ3 sing N N 152 LYS OXT HXT sing N N 153 PRO N CA sing N N 154 PRO N CD sing N N 155 PRO N H sing N N 156 PRO CA C sing N N 157 PRO CA CB sing N N 158 PRO CA HA sing N N 159 PRO C O doub N N 160 PRO C OXT sing N N 161 PRO CB CG sing N N 162 PRO CB HB2 sing N N 163 PRO CB HB3 sing N N 164 PRO CG CD sing N N 165 PRO CG HG2 sing N N 166 PRO CG HG3 sing N N 167 PRO CD HD2 sing N N 168 PRO CD HD3 sing N N 169 PRO OXT HXT sing N N 170 SER N CA sing N N 171 SER N H sing N N 172 SER N H2 sing N N 173 SER CA C sing N N 174 SER CA CB sing N N 175 SER CA HA sing N N 176 SER C O doub N N 177 SER C OXT sing N N 178 SER CB OG sing N N 179 SER CB HB2 sing N N 180 SER CB HB3 sing N N 181 SER OG HG sing N N 182 SER OXT HXT sing N N 183 THR N CA sing N N 184 THR N H sing N N 185 THR N H2 sing N N 186 THR CA C sing N N 187 THR CA CB sing N N 188 THR CA HA sing N N 189 THR C O doub N N 190 THR C OXT sing N N 191 THR CB OG1 sing N N 192 THR CB CG2 sing N N 193 THR CB HB sing N N 194 THR OG1 HG1 sing N N 195 THR CG2 HG21 sing N N 196 THR CG2 HG22 sing N N 197 THR CG2 HG23 sing N N 198 THR OXT HXT sing N N 199 TRP N CA sing N N 200 TRP N H sing N N 201 TRP N H2 sing N N 202 TRP CA C sing N N 203 TRP CA CB sing N N 204 TRP CA HA sing N N 205 TRP C O doub N N 206 TRP C OXT sing N N 207 TRP CB CG sing N N 208 TRP CB HB2 sing N N 209 TRP CB HB3 sing N N 210 TRP CG CD1 doub Y N 211 TRP CG CD2 sing Y N 212 TRP CD1 NE1 sing Y N 213 TRP CD1 HD1 sing N N 214 TRP CD2 CE2 doub Y N 215 TRP CD2 CE3 sing Y N 216 TRP NE1 CE2 sing Y N 217 TRP NE1 HE1 sing N N 218 TRP CE2 CZ2 sing Y N 219 TRP CE3 CZ3 doub Y N 220 TRP CE3 HE3 sing N N 221 TRP CZ2 CH2 doub Y N 222 TRP CZ2 HZ2 sing N N 223 TRP CZ3 CH2 sing Y N 224 TRP CZ3 HZ3 sing N N 225 TRP CH2 HH2 sing N N 226 TRP OXT HXT sing N N 227 TYR N CA sing N N 228 TYR N H sing N N 229 TYR N H2 sing N N 230 TYR CA C sing N N 231 TYR CA CB sing N N 232 TYR CA HA sing N N 233 TYR C O doub N N 234 TYR C OXT sing N N 235 TYR CB CG sing N N 236 TYR CB HB2 sing N N 237 TYR CB HB3 sing N N 238 TYR CG CD1 doub Y N 239 TYR CG CD2 sing Y N 240 TYR CD1 CE1 sing Y N 241 TYR CD1 HD1 sing N N 242 TYR CD2 CE2 doub Y N 243 TYR CD2 HD2 sing N N 244 TYR CE1 CZ doub Y N 245 TYR CE1 HE1 sing N N 246 TYR CE2 CZ sing Y N 247 TYR CE2 HE2 sing N N 248 TYR CZ OH sing N N 249 TYR OH HH sing N N 250 TYR OXT HXT sing N N 251 VAL N CA sing N N 252 VAL N H sing N N 253 VAL N H2 sing N N 254 VAL CA C sing N N 255 VAL CA CB sing N N 256 VAL CA HA sing N N 257 VAL C O doub N N 258 VAL C OXT sing N N 259 VAL CB CG1 sing N N 260 VAL CB CG2 sing N N 261 VAL CB HB sing N N 262 VAL CG1 HG11 sing N N 263 VAL CG1 HG12 sing N N 264 VAL CG1 HG13 sing N N 265 VAL CG2 HG21 sing N N 266 VAL CG2 HG22 sing N N 267 VAL CG2 HG23 sing N N 268 VAL OXT HXT sing N N 269 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 500 2 ? Bruker DRX 800 # _atom_sites.entry_id 1ED7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #