data_1EDV # _entry.id 1EDV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1EDV pdb_00001edv 10.2210/pdb1edv/pdb RCSB RCSB010474 ? ? WWPDB D_1000010474 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1EDX 'amino terminal of bovine rhodopsin' unspecified PDB 1EDS 'first intradiskal loop of bovine rhodopsin' unspecified PDB 1EDW 'Third intradiskal loop of bovine rhodopsin' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1EDV _pdbx_database_status.recvd_initial_deposition_date 2000-01-28 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yeagle, P.L.' 1 'Salloum, A.' 2 'Chopra, A.' 3 'Bhawsar, N.' 4 'Ali, L.' 5 # _citation.id primary _citation.title 'Structures of the intradiskal loops and amino terminus of the G-protein receptor, rhodopsin.' _citation.journal_abbrev J.Pept.Res. _citation.journal_volume 55 _citation.page_first 455 _citation.page_last 465 _citation.year 2000 _citation.journal_id_ASTM JPERFA _citation.country DK _citation.journal_id_ISSN 1397-002X _citation.journal_id_CSD 2150 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10888202 _citation.pdbx_database_id_DOI 10.1034/j.1399-3011.2000.00707.x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yeagle, P.L.' 1 ? primary 'Salloum, A.' 2 ? primary 'Chopra, A.' 3 ? primary 'Bhawsar, N.' 4 ? primary 'Ali, L.' 5 ? primary 'Kuzmanovski, G.' 6 ? primary 'Alderfer, J.L.' 7 ? primary 'Albert, A.D.' 8 ? # _cell.entry_id 1EDV _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1EDV _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description RHODOPSIN _entity.formula_weight 3941.338 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SECOND INTRADISKAL LOOP (RESIDUES 172-205)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code LVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVI _entity_poly.pdbx_seq_one_letter_code_can LVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVI _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 VAL n 1 3 GLY n 1 4 TRP n 1 5 SER n 1 6 ARG n 1 7 TYR n 1 8 ILE n 1 9 PRO n 1 10 GLU n 1 11 GLY n 1 12 MET n 1 13 GLN n 1 14 CYS n 1 15 SER n 1 16 CYS n 1 17 GLY n 1 18 ILE n 1 19 ASP n 1 20 TYR n 1 21 TYR n 1 22 THR n 1 23 PRO n 1 24 HIS n 1 25 GLU n 1 26 GLU n 1 27 THR n 1 28 ASN n 1 29 ASN n 1 30 GLU n 1 31 SER n 1 32 PHE n 1 33 VAL n 1 34 ILE n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'bovine rhodopsin sequence' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code OPSD_BOVIN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P02699 _struct_ref.pdbx_align_begin 172 _struct_ref.pdbx_seq_one_letter_code LVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVI _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1EDV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 34 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02699 _struct_ref_seq.db_align_beg 172 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 205 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 34 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 DQF-COSY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH ? _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2 mM peptide' _pdbx_nmr_sample_details.solvent_system DMSO # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AMX _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1EDV _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1EDV _pdbx_nmr_ensemble.conformers_calculated_total_number 150 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1EDV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal Felix ? 'data analysis' ? 1 DIANA ? refinement ? 2 # _exptl.entry_id 1EDV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1EDV _struct.title 'SOLUTION STRUCTURE OF 2ND INTRADISKAL LOOP OF BOVINE RHODOPSIN (RESIDUES 172-205)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1EDV _struct_keywords.pdbx_keywords 'Ion Transport' _struct_keywords.text 'helix-turn-helix, Ion Transport' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id TYR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 20 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 25 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id TYR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 20 _struct_conf.end_auth_comp_id GLU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 25 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 32 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 32 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 VAL _struct_mon_prot_cis.pdbx_label_seq_id_2 33 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 VAL _struct_mon_prot_cis.pdbx_auth_seq_id_2 33 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -24.06 # _database_PDB_matrix.entry_id 1EDV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1EDV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ILE 34 34 34 ILE ILE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-08-09 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -77.33 48.27 2 1 ARG A 6 ? ? -164.31 -43.85 3 1 TYR A 7 ? ? -76.28 -75.56 4 1 MET A 12 ? ? 72.08 -51.31 5 1 CYS A 14 ? ? -82.23 44.91 6 1 SER A 15 ? ? -179.41 -150.01 7 1 CYS A 16 ? ? -160.45 -39.53 8 1 ILE A 18 ? ? 58.44 90.97 9 1 TYR A 20 ? ? -67.99 -92.32 10 1 HIS A 24 ? ? -177.30 95.00 11 1 GLU A 26 ? ? -75.43 41.76 12 1 THR A 27 ? ? 173.07 45.60 13 1 ASN A 28 ? ? -169.67 -58.64 14 1 ASN A 29 ? ? -85.07 -88.37 15 1 PHE A 32 ? ? -167.13 55.16 16 1 VAL A 33 ? ? 58.64 174.79 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 20 ? ? 0.073 'SIDE CHAIN' 2 1 TYR A 21 ? ? 0.133 'SIDE CHAIN' #