data_1EGT # _entry.id 1EGT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1EGT pdb_00001egt 10.2210/pdb1egt/pdb WWPDB D_1000173050 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-11-15 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1EGT _pdbx_database_status.recvd_initial_deposition_date 1994-10-12 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _audit_author.name 'Ni, F.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Thrombin-bound structure of an EGF subdomain from human thrombomodulin determined by transferred nuclear Overhauser effects.' _citation.journal_abbrev Biochemistry _citation.journal_volume 33 _citation.page_first 13553 _citation.page_last 13560 _citation.year 1994 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 7947766 _citation.pdbx_database_id_DOI 10.1021/bi00250a007 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Srinivasan, J.' 1 ? primary 'Hu, S.' 2 ? primary 'Hrabal, R.' 3 ? primary 'Zhu, Y.' 4 ? primary 'Komives, E.A.' 5 ? primary 'Ni, F.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description THROMBOMODULIN _entity.formula_weight 1905.023 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'DEL(ILE 420)' _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code CPEGYILDDGFCTDIDE _entity_poly.pdbx_seq_one_letter_code_can CPEGYILDDGFCTDIDE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 PRO n 1 3 GLU n 1 4 GLY n 1 5 TYR n 1 6 ILE n 1 7 LEU n 1 8 ASP n 1 9 ASP n 1 10 GLY n 1 11 PHE n 1 12 CYS n 1 13 THR n 1 14 ASP n 1 15 ILE n 1 16 ASP n 1 17 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 1 1 CYS CYS A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 GLU 17 17 17 GLU GLU A . n # _cell.entry_id 1EGT _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1EGT _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1EGT _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1EGT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1EGT _struct.title 'THROMBIN-BOUND STRUCTURE OF AN EGF SUBDOMAIN FROM HUMAN THROMBOMODULIN DETERMINED BY TRANSFERRED NUCLEAR OVERHAUSER EFFECTS' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1EGT _struct_keywords.pdbx_keywords 'BLOOD COAGULATION INHIBITOR' _struct_keywords.text 'EGF, EPIDERMAL GROWTH FACTOR, BLOOD COAGULATION INHIBITOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRBM_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P07204 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MLGVLVLGALALAGLGFPAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADVISLLLNGDGG VGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEV KADGFLCEFHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAP GAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSCTASATQSCNDLCEHFCVPNPDQPGSYSCMCETGYRLAADQ HRCEDVDDCILEPSPCPQRCVNTQGGFECHCYPNYDLVDGECVEPVDPCFRANCEYQCQPLNQTSYLCVCAEGFAPIPHE PHRCQMFCNQTACPADCDPNTQASCECPEGYILDDGFICTDIDECENGGFCSGVCHNLPGTFECICGPDSALARHIGTDC DSGKVDGGDSGSGEPPPSPTPGSTLTPPAVGLVHSGLLIGISIASLCLVVALLALLCHLRKKQGAARAKMEYKCAAPSKE VVLQHVRTERTPQRL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1EGT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 17 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07204 _struct_ref_seq.db_align_beg 427 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 444 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 17 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1EGT _struct_ref_seq_dif.mon_id ? _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num ? _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P07204 _struct_ref_seq_dif.db_mon_id ILE _struct_ref_seq_dif.pdbx_seq_db_seq_num 438 _struct_ref_seq_dif.details deletion _struct_ref_seq_dif.pdbx_auth_seq_num ? _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 12 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 1 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 12 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.038 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 1 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 12 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 1 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 12 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 5 ? LEU A 7 ? TYR A 5 LEU A 7 A 2 CYS A 12 ? ASP A 14 ? CYS A 12 ASP A 14 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 6 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 6 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id THR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 13 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id THR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 13 # _pdbx_entry_details.entry_id 1EGT _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 8 ? ? -121.24 -73.61 2 1 ASP A 9 ? ? -101.74 53.68 3 2 ASP A 8 ? ? -144.60 -67.84 4 2 ASP A 9 ? ? -108.49 48.89 5 3 ASP A 16 ? ? 51.37 79.72 # _pdbx_nmr_ensemble.entry_id 1EGT _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 3 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name ECEPP/MCM _pdbx_nmr_software.version ? _pdbx_nmr_software.authors RIPOLL,SCHERAGA _pdbx_nmr_software.ordinal 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ASP N N N N 1 ASP CA C N S 2 ASP C C N N 3 ASP O O N N 4 ASP CB C N N 5 ASP CG C N N 6 ASP OD1 O N N 7 ASP OD2 O N N 8 ASP OXT O N N 9 ASP H H N N 10 ASP H2 H N N 11 ASP HA H N N 12 ASP HB2 H N N 13 ASP HB3 H N N 14 ASP HD2 H N N 15 ASP HXT H N N 16 CYS N N N N 17 CYS CA C N R 18 CYS C C N N 19 CYS O O N N 20 CYS CB C N N 21 CYS SG S N N 22 CYS OXT O N N 23 CYS H H N N 24 CYS H2 H N N 25 CYS HA H N N 26 CYS HB2 H N N 27 CYS HB3 H N N 28 CYS HG H N N 29 CYS HXT H N N 30 GLU N N N N 31 GLU CA C N S 32 GLU C C N N 33 GLU O O N N 34 GLU CB C N N 35 GLU CG C N N 36 GLU CD C N N 37 GLU OE1 O N N 38 GLU OE2 O N N 39 GLU OXT O N N 40 GLU H H N N 41 GLU H2 H N N 42 GLU HA H N N 43 GLU HB2 H N N 44 GLU HB3 H N N 45 GLU HG2 H N N 46 GLU HG3 H N N 47 GLU HE2 H N N 48 GLU HXT H N N 49 GLY N N N N 50 GLY CA C N N 51 GLY C C N N 52 GLY O O N N 53 GLY OXT O N N 54 GLY H H N N 55 GLY H2 H N N 56 GLY HA2 H N N 57 GLY HA3 H N N 58 GLY HXT H N N 59 ILE N N N N 60 ILE CA C N S 61 ILE C C N N 62 ILE O O N N 63 ILE CB C N S 64 ILE CG1 C N N 65 ILE CG2 C N N 66 ILE CD1 C N N 67 ILE OXT O N N 68 ILE H H N N 69 ILE H2 H N N 70 ILE HA H N N 71 ILE HB H N N 72 ILE HG12 H N N 73 ILE HG13 H N N 74 ILE HG21 H N N 75 ILE HG22 H N N 76 ILE HG23 H N N 77 ILE HD11 H N N 78 ILE HD12 H N N 79 ILE HD13 H N N 80 ILE HXT H N N 81 LEU N N N N 82 LEU CA C N S 83 LEU C C N N 84 LEU O O N N 85 LEU CB C N N 86 LEU CG C N N 87 LEU CD1 C N N 88 LEU CD2 C N N 89 LEU OXT O N N 90 LEU H H N N 91 LEU H2 H N N 92 LEU HA H N N 93 LEU HB2 H N N 94 LEU HB3 H N N 95 LEU HG H N N 96 LEU HD11 H N N 97 LEU HD12 H N N 98 LEU HD13 H N N 99 LEU HD21 H N N 100 LEU HD22 H N N 101 LEU HD23 H N N 102 LEU HXT H N N 103 PHE N N N N 104 PHE CA C N S 105 PHE C C N N 106 PHE O O N N 107 PHE CB C N N 108 PHE CG C Y N 109 PHE CD1 C Y N 110 PHE CD2 C Y N 111 PHE CE1 C Y N 112 PHE CE2 C Y N 113 PHE CZ C Y N 114 PHE OXT O N N 115 PHE H H N N 116 PHE H2 H N N 117 PHE HA H N N 118 PHE HB2 H N N 119 PHE HB3 H N N 120 PHE HD1 H N N 121 PHE HD2 H N N 122 PHE HE1 H N N 123 PHE HE2 H N N 124 PHE HZ H N N 125 PHE HXT H N N 126 PRO N N N N 127 PRO CA C N S 128 PRO C C N N 129 PRO O O N N 130 PRO CB C N N 131 PRO CG C N N 132 PRO CD C N N 133 PRO OXT O N N 134 PRO H H N N 135 PRO HA H N N 136 PRO HB2 H N N 137 PRO HB3 H N N 138 PRO HG2 H N N 139 PRO HG3 H N N 140 PRO HD2 H N N 141 PRO HD3 H N N 142 PRO HXT H N N 143 THR N N N N 144 THR CA C N S 145 THR C C N N 146 THR O O N N 147 THR CB C N R 148 THR OG1 O N N 149 THR CG2 C N N 150 THR OXT O N N 151 THR H H N N 152 THR H2 H N N 153 THR HA H N N 154 THR HB H N N 155 THR HG1 H N N 156 THR HG21 H N N 157 THR HG22 H N N 158 THR HG23 H N N 159 THR HXT H N N 160 TYR N N N N 161 TYR CA C N S 162 TYR C C N N 163 TYR O O N N 164 TYR CB C N N 165 TYR CG C Y N 166 TYR CD1 C Y N 167 TYR CD2 C Y N 168 TYR CE1 C Y N 169 TYR CE2 C Y N 170 TYR CZ C Y N 171 TYR OH O N N 172 TYR OXT O N N 173 TYR H H N N 174 TYR H2 H N N 175 TYR HA H N N 176 TYR HB2 H N N 177 TYR HB3 H N N 178 TYR HD1 H N N 179 TYR HD2 H N N 180 TYR HE1 H N N 181 TYR HE2 H N N 182 TYR HH H N N 183 TYR HXT H N N 184 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ASP N CA sing N N 1 ASP N H sing N N 2 ASP N H2 sing N N 3 ASP CA C sing N N 4 ASP CA CB sing N N 5 ASP CA HA sing N N 6 ASP C O doub N N 7 ASP C OXT sing N N 8 ASP CB CG sing N N 9 ASP CB HB2 sing N N 10 ASP CB HB3 sing N N 11 ASP CG OD1 doub N N 12 ASP CG OD2 sing N N 13 ASP OD2 HD2 sing N N 14 ASP OXT HXT sing N N 15 CYS N CA sing N N 16 CYS N H sing N N 17 CYS N H2 sing N N 18 CYS CA C sing N N 19 CYS CA CB sing N N 20 CYS CA HA sing N N 21 CYS C O doub N N 22 CYS C OXT sing N N 23 CYS CB SG sing N N 24 CYS CB HB2 sing N N 25 CYS CB HB3 sing N N 26 CYS SG HG sing N N 27 CYS OXT HXT sing N N 28 GLU N CA sing N N 29 GLU N H sing N N 30 GLU N H2 sing N N 31 GLU CA C sing N N 32 GLU CA CB sing N N 33 GLU CA HA sing N N 34 GLU C O doub N N 35 GLU C OXT sing N N 36 GLU CB CG sing N N 37 GLU CB HB2 sing N N 38 GLU CB HB3 sing N N 39 GLU CG CD sing N N 40 GLU CG HG2 sing N N 41 GLU CG HG3 sing N N 42 GLU CD OE1 doub N N 43 GLU CD OE2 sing N N 44 GLU OE2 HE2 sing N N 45 GLU OXT HXT sing N N 46 GLY N CA sing N N 47 GLY N H sing N N 48 GLY N H2 sing N N 49 GLY CA C sing N N 50 GLY CA HA2 sing N N 51 GLY CA HA3 sing N N 52 GLY C O doub N N 53 GLY C OXT sing N N 54 GLY OXT HXT sing N N 55 ILE N CA sing N N 56 ILE N H sing N N 57 ILE N H2 sing N N 58 ILE CA C sing N N 59 ILE CA CB sing N N 60 ILE CA HA sing N N 61 ILE C O doub N N 62 ILE C OXT sing N N 63 ILE CB CG1 sing N N 64 ILE CB CG2 sing N N 65 ILE CB HB sing N N 66 ILE CG1 CD1 sing N N 67 ILE CG1 HG12 sing N N 68 ILE CG1 HG13 sing N N 69 ILE CG2 HG21 sing N N 70 ILE CG2 HG22 sing N N 71 ILE CG2 HG23 sing N N 72 ILE CD1 HD11 sing N N 73 ILE CD1 HD12 sing N N 74 ILE CD1 HD13 sing N N 75 ILE OXT HXT sing N N 76 LEU N CA sing N N 77 LEU N H sing N N 78 LEU N H2 sing N N 79 LEU CA C sing N N 80 LEU CA CB sing N N 81 LEU CA HA sing N N 82 LEU C O doub N N 83 LEU C OXT sing N N 84 LEU CB CG sing N N 85 LEU CB HB2 sing N N 86 LEU CB HB3 sing N N 87 LEU CG CD1 sing N N 88 LEU CG CD2 sing N N 89 LEU CG HG sing N N 90 LEU CD1 HD11 sing N N 91 LEU CD1 HD12 sing N N 92 LEU CD1 HD13 sing N N 93 LEU CD2 HD21 sing N N 94 LEU CD2 HD22 sing N N 95 LEU CD2 HD23 sing N N 96 LEU OXT HXT sing N N 97 PHE N CA sing N N 98 PHE N H sing N N 99 PHE N H2 sing N N 100 PHE CA C sing N N 101 PHE CA CB sing N N 102 PHE CA HA sing N N 103 PHE C O doub N N 104 PHE C OXT sing N N 105 PHE CB CG sing N N 106 PHE CB HB2 sing N N 107 PHE CB HB3 sing N N 108 PHE CG CD1 doub Y N 109 PHE CG CD2 sing Y N 110 PHE CD1 CE1 sing Y N 111 PHE CD1 HD1 sing N N 112 PHE CD2 CE2 doub Y N 113 PHE CD2 HD2 sing N N 114 PHE CE1 CZ doub Y N 115 PHE CE1 HE1 sing N N 116 PHE CE2 CZ sing Y N 117 PHE CE2 HE2 sing N N 118 PHE CZ HZ sing N N 119 PHE OXT HXT sing N N 120 PRO N CA sing N N 121 PRO N CD sing N N 122 PRO N H sing N N 123 PRO CA C sing N N 124 PRO CA CB sing N N 125 PRO CA HA sing N N 126 PRO C O doub N N 127 PRO C OXT sing N N 128 PRO CB CG sing N N 129 PRO CB HB2 sing N N 130 PRO CB HB3 sing N N 131 PRO CG CD sing N N 132 PRO CG HG2 sing N N 133 PRO CG HG3 sing N N 134 PRO CD HD2 sing N N 135 PRO CD HD3 sing N N 136 PRO OXT HXT sing N N 137 THR N CA sing N N 138 THR N H sing N N 139 THR N H2 sing N N 140 THR CA C sing N N 141 THR CA CB sing N N 142 THR CA HA sing N N 143 THR C O doub N N 144 THR C OXT sing N N 145 THR CB OG1 sing N N 146 THR CB CG2 sing N N 147 THR CB HB sing N N 148 THR OG1 HG1 sing N N 149 THR CG2 HG21 sing N N 150 THR CG2 HG22 sing N N 151 THR CG2 HG23 sing N N 152 THR OXT HXT sing N N 153 TYR N CA sing N N 154 TYR N H sing N N 155 TYR N H2 sing N N 156 TYR CA C sing N N 157 TYR CA CB sing N N 158 TYR CA HA sing N N 159 TYR C O doub N N 160 TYR C OXT sing N N 161 TYR CB CG sing N N 162 TYR CB HB2 sing N N 163 TYR CB HB3 sing N N 164 TYR CG CD1 doub Y N 165 TYR CG CD2 sing Y N 166 TYR CD1 CE1 sing Y N 167 TYR CD1 HD1 sing N N 168 TYR CD2 CE2 doub Y N 169 TYR CD2 HD2 sing N N 170 TYR CE1 CZ doub Y N 171 TYR CE1 HE1 sing N N 172 TYR CE2 CZ sing Y N 173 TYR CE2 HE2 sing N N 174 TYR CZ OH sing N N 175 TYR OH HH sing N N 176 TYR OXT HXT sing N N 177 # _atom_sites.entry_id 1EGT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_