data_1EKR # _entry.id 1EKR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1EKR pdb_00001ekr 10.2210/pdb1ekr/pdb RCSB RCSB010683 ? ? WWPDB D_1000010683 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1EKS _pdbx_database_related.details 'ASP128ALA VARIANT OF MOAC PROTEIN FROM E. COLI' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1EKR _pdbx_database_status.recvd_initial_deposition_date 2000-03-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Schindelin, H.' 1 'Liu, M.T.W.' 2 'Wuebbens, M.M.' 3 'Rajagopalan, K.V.' 4 # _citation.id primary _citation.title ;Insights into molybdenum cofactor deficiency provided by the crystal structure of the molybdenum cofactor biosynthesis protein MoaC. ; _citation.journal_abbrev 'Structure Fold.Des.' _citation.journal_volume 8 _citation.page_first 709 _citation.page_last 717 _citation.year 2000 _citation.journal_id_ASTM FODEFH _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 1263 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10903949 _citation.pdbx_database_id_DOI '10.1016/S0969-2126(00)00157-X' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wuebbens, M.M.' 1 ? primary 'Liu, M.T.' 2 ? primary 'Rajagopalan, K.' 3 ? primary 'Schindelin, H.' 4 ? # _cell.entry_id 1EKR _cell.length_a 91.117 _cell.length_b 91.117 _cell.length_c 62.722 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1EKR _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN C' 17477.277 1 ? S2A ? ? 2 water nat water 18.015 41 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAQLTHINAAGEAHMVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLM LSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSGGKSGDFKVEAD D ; _entity_poly.pdbx_seq_one_letter_code_can ;MAQLTHINAAGEAHMVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLM LSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSGGKSGDFKVEAD D ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLN n 1 4 LEU n 1 5 THR n 1 6 HIS n 1 7 ILE n 1 8 ASN n 1 9 ALA n 1 10 ALA n 1 11 GLY n 1 12 GLU n 1 13 ALA n 1 14 HIS n 1 15 MET n 1 16 VAL n 1 17 ASP n 1 18 VAL n 1 19 SER n 1 20 ALA n 1 21 LYS n 1 22 ALA n 1 23 GLU n 1 24 THR n 1 25 VAL n 1 26 ARG n 1 27 GLU n 1 28 ALA n 1 29 ARG n 1 30 ALA n 1 31 GLU n 1 32 ALA n 1 33 PHE n 1 34 VAL n 1 35 THR n 1 36 MET n 1 37 ARG n 1 38 SER n 1 39 GLU n 1 40 THR n 1 41 LEU n 1 42 ALA n 1 43 MET n 1 44 ILE n 1 45 ILE n 1 46 ASP n 1 47 GLY n 1 48 ARG n 1 49 HIS n 1 50 HIS n 1 51 LYS n 1 52 GLY n 1 53 ASP n 1 54 VAL n 1 55 PHE n 1 56 ALA n 1 57 THR n 1 58 ALA n 1 59 ARG n 1 60 ILE n 1 61 ALA n 1 62 GLY n 1 63 ILE n 1 64 GLN n 1 65 ALA n 1 66 ALA n 1 67 LYS n 1 68 ARG n 1 69 THR n 1 70 TRP n 1 71 ASP n 1 72 LEU n 1 73 ILE n 1 74 PRO n 1 75 LEU n 1 76 CYS n 1 77 HIS n 1 78 PRO n 1 79 LEU n 1 80 MET n 1 81 LEU n 1 82 SER n 1 83 LYS n 1 84 VAL n 1 85 GLU n 1 86 VAL n 1 87 ASN n 1 88 LEU n 1 89 GLN n 1 90 ALA n 1 91 GLU n 1 92 PRO n 1 93 GLU n 1 94 HIS n 1 95 ASN n 1 96 ARG n 1 97 VAL n 1 98 ARG n 1 99 ILE n 1 100 GLU n 1 101 THR n 1 102 LEU n 1 103 CYS n 1 104 ARG n 1 105 LEU n 1 106 THR n 1 107 GLY n 1 108 LYS n 1 109 THR n 1 110 GLY n 1 111 VAL n 1 112 GLU n 1 113 MET n 1 114 GLU n 1 115 ALA n 1 116 LEU n 1 117 THR n 1 118 ALA n 1 119 ALA n 1 120 SER n 1 121 VAL n 1 122 ALA n 1 123 ALA n 1 124 LEU n 1 125 THR n 1 126 ILE n 1 127 TYR n 1 128 ASP n 1 129 MET n 1 130 CYS n 1 131 LYS n 1 132 ALA n 1 133 VAL n 1 134 GLN n 1 135 LYS n 1 136 ASP n 1 137 MET n 1 138 VAL n 1 139 ILE n 1 140 GLY n 1 141 PRO n 1 142 VAL n 1 143 ARG n 1 144 LEU n 1 145 LEU n 1 146 ALA n 1 147 LYS n 1 148 SER n 1 149 GLY n 1 150 GLY n 1 151 LYS n 1 152 SER n 1 153 GLY n 1 154 ASP n 1 155 PHE n 1 156 LYS n 1 157 VAL n 1 158 GLU n 1 159 ALA n 1 160 ASP n 1 161 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location CYTOSOL _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PET 15B' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_code MOAC_ECOLI _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P0A738 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MSQLTHINAAGEAHMVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLM LSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSGGKSGDFKVEAD D ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1EKR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 161 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A738 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 161 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 161 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1EKR _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 2 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P0A738 _struct_ref_seq_dif.db_mon_id SER _struct_ref_seq_dif.pdbx_seq_db_seq_num 2 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 2 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1EKR _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 42.78 _exptl_crystal.density_Matthews 2.15 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.temp 295.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details 'PEG 400, CALCIUM CHLORIDE, HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 22K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 95 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 1998-03-15 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X26C' _diffrn_source.pdbx_wavelength 1.1 _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X26C _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1EKR _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 1.95 _reflns.number_obs 11190 _reflns.number_all 57577 _reflns.percent_possible_obs 95.7 _reflns.pdbx_Rmerge_I_obs 0.0630000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 29.1 _reflns.B_iso_Wilson_estimate 48 _reflns.pdbx_redundancy 5.1 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.95 _reflns_shell.d_res_low 2.02 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 95.7 _reflns_shell.Rmerge_I_obs 0.4970000 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy 3.9 _reflns_shell.number_unique_all 1083 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1EKR _refine.ls_number_reflns_obs 9352 _refine.ls_number_reflns_all 10368 _refine.pdbx_ls_sigma_I 0.0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 2.0 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2193000 _refine.ls_R_factor_R_free 0.2516000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 1016 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details 'Partial structure factors for bulk solvent were calculated in XPLOR and incorporated into REFMAC' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values Lamzin _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details Random _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1081 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 41 _refine_hist.number_atoms_total 1122 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? p_angle_d 0.025 ? ? ? 'X-RAY DIFFRACTION' ? 'planar groups (peptides)' 0.0154 ? ? ? 'X-RAY DIFFRACTION' ? 'planar groups (aromatics)' 0.0053 ? ? ? 'X-RAY DIFFRACTION' ? 'chiral volumes' 0.099 ? ? ? 'X-RAY DIFFRACTION' ? 'torsion angles (planar)' 3.4 ? ? ? 'X-RAY DIFFRACTION' ? 'torsion angles (staggered)' 19.6 ? ? ? 'X-RAY DIFFRACTION' ? 'torsion angles (orthonormal)' 36.7 ? ? ? 'X-RAY DIFFRACTION' ? 'B-factors (main chain bond)' 4.00 ? ? ? 'X-RAY DIFFRACTION' ? 'B-factors (main chain angle)' 5.38 ? ? ? 'X-RAY DIFFRACTION' ? 'B-factors (side chain bond)' 4.52 ? ? ? 'X-RAY DIFFRACTION' ? 'B-factors (side chain angle)' 5.95 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1EKR _struct.title 'MOAC PROTEIN FROM E. COLI' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1EKR _struct_keywords.pdbx_keywords TRANSLATION _struct_keywords.text 'MoaC, Molybdenum cofactor (Moco), Moco biosynthesis, Moco deficiency, TRANSLATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details 'The biological assembly is a hexamer with 32 symmetry generated from chain A by crystallographic symmetry operations' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 37 ? ASP A 46 ? ARG A 37 ASP A 46 1 ? 10 HELX_P HELX_P2 2 ASP A 53 ? ARG A 68 ? ASP A 53 ARG A 68 1 ? 16 HELX_P HELX_P3 3 ARG A 68 ? ILE A 73 ? ARG A 68 ILE A 73 1 ? 6 HELX_P HELX_P4 4 PRO A 92 ? HIS A 94 ? PRO A 92 HIS A 94 5 ? 3 HELX_P HELX_P5 5 VAL A 111 ? LYS A 131 ? VAL A 111 LYS A 131 1 ? 21 HELX_P HELX_P6 6 ALA A 132 ? GLN A 134 ? ALA A 132 GLN A 134 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASP 46 A . ? ASP 46 A GLY 47 A ? GLY 47 A 1 -0.45 2 GLY 140 A . ? GLY 140 A PRO 141 A ? PRO 141 A 1 0.92 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 83 ? GLU A 91 ? LYS A 83 GLU A 91 A 2 ARG A 96 ? GLY A 107 ? ARG A 96 GLY A 107 A 3 THR A 24 ? THR A 35 ? THR A 24 THR A 35 A 4 VAL A 138 ? LYS A 147 ? VAL A 138 LYS A 147 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 91 ? N GLU A 91 O ARG A 96 ? O ARG A 96 A 2 3 N GLY A 107 ? N GLY A 107 O THR A 24 ? O THR A 24 A 3 4 N THR A 35 ? N THR A 35 O VAL A 138 ? O VAL A 138 # _database_PDB_matrix.entry_id 1EKR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1EKR _atom_sites.fract_transf_matrix[1][1] 0.01097 _atom_sites.fract_transf_matrix[1][2] 0.00634 _atom_sites.fract_transf_matrix[1][3] 0.00000 _atom_sites.fract_transf_matrix[2][1] 0.00000 _atom_sites.fract_transf_matrix[2][2] 0.01267 _atom_sites.fract_transf_matrix[2][3] 0.00000 _atom_sites.fract_transf_matrix[3][1] 0.00000 _atom_sites.fract_transf_matrix[3][2] 0.00000 _atom_sites.fract_transf_matrix[3][3] 0.01594 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 LEU 4 4 ? ? ? A . n A 1 5 THR 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 ILE 7 7 ? ? ? A . n A 1 8 ASN 8 8 ? ? ? A . n A 1 9 ALA 9 9 ? ? ? A . n A 1 10 ALA 10 10 ? ? ? A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ASP 17 17 17 ASP ASN A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 TRP 70 70 70 TRP TRP A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 CYS 103 103 103 CYS CYS A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 LYS 108 108 108 LYS ALA A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 MET 113 113 113 MET MET A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 MET 129 129 129 MET MET A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 GLN 134 134 134 GLN GLN A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 MET 137 137 137 MET MET A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 GLY 149 149 ? ? ? A . n A 1 150 GLY 150 150 ? ? ? A . n A 1 151 LYS 151 151 ? ? ? A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 LYS 156 156 156 LYS ALA A . n A 1 157 VAL 157 157 ? ? ? A . n A 1 158 GLU 158 158 ? ? ? A . n A 1 159 ALA 159 159 ? ? ? A . n A 1 160 ASP 160 160 ? ? ? A . n A 1 161 ASP 161 161 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 162 1 HOH WAT A . B 2 HOH 2 163 2 HOH WAT A . B 2 HOH 3 164 3 HOH WAT A . B 2 HOH 4 165 4 HOH WAT A . B 2 HOH 5 166 5 HOH WAT A . B 2 HOH 6 167 6 HOH WAT A . B 2 HOH 7 168 7 HOH WAT A . B 2 HOH 8 169 8 HOH WAT A . B 2 HOH 9 170 9 HOH WAT A . B 2 HOH 10 171 10 HOH WAT A . B 2 HOH 11 172 11 HOH WAT A . B 2 HOH 12 173 12 HOH WAT A . B 2 HOH 13 174 13 HOH WAT A . B 2 HOH 14 175 14 HOH WAT A . B 2 HOH 15 176 15 HOH WAT A . B 2 HOH 16 177 16 HOH WAT A . B 2 HOH 17 178 17 HOH WAT A . B 2 HOH 18 179 18 HOH WAT A . B 2 HOH 19 180 19 HOH WAT A . B 2 HOH 20 181 20 HOH WAT A . B 2 HOH 21 182 21 HOH WAT A . B 2 HOH 22 183 22 HOH WAT A . B 2 HOH 23 184 23 HOH WAT A . B 2 HOH 24 185 24 HOH WAT A . B 2 HOH 25 186 25 HOH WAT A . B 2 HOH 26 187 26 HOH WAT A . B 2 HOH 27 188 27 HOH WAT A . B 2 HOH 28 189 28 HOH WAT A . B 2 HOH 29 190 29 HOH WAT A . B 2 HOH 30 191 30 HOH WAT A . B 2 HOH 31 192 31 HOH WAT A . B 2 HOH 32 193 32 HOH WAT A . B 2 HOH 33 194 33 HOH WAT A . B 2 HOH 34 195 34 HOH WAT A . B 2 HOH 35 196 35 HOH WAT A . B 2 HOH 36 197 36 HOH WAT A . B 2 HOH 37 198 37 HOH WAT A . B 2 HOH 38 199 38 HOH WAT A . B 2 HOH 39 200 39 HOH WAT A . B 2 HOH 40 201 40 HOH WAT A . B 2 HOH 41 202 41 HOH WAT A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 20290 ? 1 MORE -134 ? 1 'SSA (A^2)' 28520 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -y+1,x-y,z -0.5000000000 -0.8660254038 0.0000000000 91.1170000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038 0.0000000000 45.5585000000 -0.8660254038 -0.5000000000 0.0000000000 78.9096367166 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 10_666 -y+1,-x+1,-z+3/2 0.5000000000 -0.8660254038 0.0000000000 45.5585000000 -0.8660254038 -0.5000000000 0.0000000000 78.9096367166 0.0000000000 0.0000000000 -1.0000000000 94.0830000000 5 'crystal symmetry operation' 11_656 -x+y+1,y,-z+3/2 -1.0000000000 0.0000000000 0.0000000000 91.1170000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 94.0830000000 6 'crystal symmetry operation' 12_556 x,x-y,-z+3/2 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 94.0830000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-09-20 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-01-31 5 'Structure model' 1 4 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Experimental preparation' 5 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' exptl_crystal_grow 2 5 'Structure model' database_2 3 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_exptl_crystal_grow.temp' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' 4 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SHARP phasing . ? 1 REFMAC refinement . ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CG _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLN _pdbx_validate_rmsd_bond.auth_seq_id_1 64 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 A _pdbx_validate_rmsd_bond.auth_atom_id_2 CD _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLN _pdbx_validate_rmsd_bond.auth_seq_id_2 64 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 A _pdbx_validate_rmsd_bond.bond_value 1.354 _pdbx_validate_rmsd_bond.bond_target_value 1.506 _pdbx_validate_rmsd_bond.bond_deviation -0.152 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.023 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 37 ? ? CZ A ARG 37 ? ? NH2 A ARG 37 ? ? 115.57 120.30 -4.73 0.50 N 2 1 N A ASP 46 ? ? CA A ASP 46 ? ? C A ASP 46 ? ? 140.28 111.00 29.28 2.70 N 3 1 CA A ASP 46 ? ? C A ASP 46 ? ? N A GLY 47 ? ? 130.65 116.20 14.45 2.00 Y 4 1 CA A GLY 47 ? ? C A GLY 47 ? ? O A GLY 47 ? ? 132.75 120.60 12.15 1.80 N 5 1 CB A GLN 64 ? A CG A GLN 64 ? A CD A GLN 64 ? A 129.39 111.60 17.79 2.60 N 6 1 CG A GLN 64 ? A CD A GLN 64 ? A NE2 A GLN 64 ? A 92.42 116.70 -24.28 2.40 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 14 ? ? -166.44 104.34 2 1 LYS A 21 ? ? -145.26 -13.00 3 1 ALA A 22 ? ? 70.27 156.55 4 1 ARG A 48 ? ? 54.16 178.99 5 1 ASP A 53 ? ? -69.60 98.57 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 ILE A 45 ? ? -11.05 2 1 LEU A 79 ? ? 13.35 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id GLN _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 64 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.106 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 108 ? CG ? A LYS 108 CG 2 1 Y 1 A LYS 108 ? CD ? A LYS 108 CD 3 1 Y 1 A LYS 108 ? CE ? A LYS 108 CE 4 1 Y 1 A LYS 108 ? NZ ? A LYS 108 NZ 5 1 Y 1 A LYS 156 ? CG ? A LYS 156 CG 6 1 Y 1 A LYS 156 ? CD ? A LYS 156 CD 7 1 Y 1 A LYS 156 ? CE ? A LYS 156 CE 8 1 Y 1 A LYS 156 ? NZ ? A LYS 156 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A LEU 4 ? A LEU 4 5 1 Y 1 A THR 5 ? A THR 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A ILE 7 ? A ILE 7 8 1 Y 1 A ASN 8 ? A ASN 8 9 1 Y 1 A ALA 9 ? A ALA 9 10 1 Y 1 A ALA 10 ? A ALA 10 11 1 Y 1 A GLY 149 ? A GLY 149 12 1 Y 1 A GLY 150 ? A GLY 150 13 1 Y 1 A LYS 151 ? A LYS 151 14 1 Y 1 A VAL 157 ? A VAL 157 15 1 Y 1 A GLU 158 ? A GLU 158 16 1 Y 1 A ALA 159 ? A ALA 159 17 1 Y 1 A ASP 160 ? A ASP 160 18 1 Y 1 A ASP 161 ? A ASP 161 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #