data_1EKS # _entry.id 1EKS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1EKS pdb_00001eks 10.2210/pdb1eks/pdb RCSB RCSB010684 ? ? WWPDB D_1000010684 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1EKR _pdbx_database_related.details MOAC _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1EKS _pdbx_database_status.recvd_initial_deposition_date 2000-03-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Schindelin, H.' 1 'Liu, M.T.W.' 2 'Wuebbens, M.M.' 3 'Rajagopalan, K.V.' 4 # _citation.id primary _citation.title ;Insights into molybdenum cofactor deficiency provided by the crystal structure of the molybdenum cofactor biosynthesis protein MoaC. ; _citation.journal_abbrev 'Structure Fold.Des.' _citation.journal_volume 8 _citation.page_first 709 _citation.page_last 718 _citation.year 2000 _citation.journal_id_ASTM FODEFH _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 1263 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10903949 _citation.pdbx_database_id_DOI '10.1016/S0969-2126(00)00157-X' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wuebbens, M.M.' 1 ? primary 'Liu, M.T.' 2 ? primary 'Rajagopalan, K.' 3 ? primary 'Schindelin, H.' 4 ? # _cell.entry_id 1EKS _cell.length_a 92.128 _cell.length_b 92.128 _cell.length_c 63.289 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1EKS _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN C' 17433.268 1 ? S2A ? ? 2 non-polymer syn 'L(+)-TARTARIC ACID' 150.087 1 ? ? ? ? 3 water nat water 18.015 4 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAQLTHINAAGEAHMVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLM LSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYAMCKAVQKDMVIGPVRLLAKSGGKSGDFKVEAD D ; _entity_poly.pdbx_seq_one_letter_code_can ;MAQLTHINAAGEAHMVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLM LSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYAMCKAVQKDMVIGPVRLLAKSGGKSGDFKVEAD D ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLN n 1 4 LEU n 1 5 THR n 1 6 HIS n 1 7 ILE n 1 8 ASN n 1 9 ALA n 1 10 ALA n 1 11 GLY n 1 12 GLU n 1 13 ALA n 1 14 HIS n 1 15 MET n 1 16 VAL n 1 17 ASP n 1 18 VAL n 1 19 SER n 1 20 ALA n 1 21 LYS n 1 22 ALA n 1 23 GLU n 1 24 THR n 1 25 VAL n 1 26 ARG n 1 27 GLU n 1 28 ALA n 1 29 ARG n 1 30 ALA n 1 31 GLU n 1 32 ALA n 1 33 PHE n 1 34 VAL n 1 35 THR n 1 36 MET n 1 37 ARG n 1 38 SER n 1 39 GLU n 1 40 THR n 1 41 LEU n 1 42 ALA n 1 43 MET n 1 44 ILE n 1 45 ILE n 1 46 ASP n 1 47 GLY n 1 48 ARG n 1 49 HIS n 1 50 HIS n 1 51 LYS n 1 52 GLY n 1 53 ASP n 1 54 VAL n 1 55 PHE n 1 56 ALA n 1 57 THR n 1 58 ALA n 1 59 ARG n 1 60 ILE n 1 61 ALA n 1 62 GLY n 1 63 ILE n 1 64 GLN n 1 65 ALA n 1 66 ALA n 1 67 LYS n 1 68 ARG n 1 69 THR n 1 70 TRP n 1 71 ASP n 1 72 LEU n 1 73 ILE n 1 74 PRO n 1 75 LEU n 1 76 CYS n 1 77 HIS n 1 78 PRO n 1 79 LEU n 1 80 MET n 1 81 LEU n 1 82 SER n 1 83 LYS n 1 84 VAL n 1 85 GLU n 1 86 VAL n 1 87 ASN n 1 88 LEU n 1 89 GLN n 1 90 ALA n 1 91 GLU n 1 92 PRO n 1 93 GLU n 1 94 HIS n 1 95 ASN n 1 96 ARG n 1 97 VAL n 1 98 ARG n 1 99 ILE n 1 100 GLU n 1 101 THR n 1 102 LEU n 1 103 CYS n 1 104 ARG n 1 105 LEU n 1 106 THR n 1 107 GLY n 1 108 LYS n 1 109 THR n 1 110 GLY n 1 111 VAL n 1 112 GLU n 1 113 MET n 1 114 GLU n 1 115 ALA n 1 116 LEU n 1 117 THR n 1 118 ALA n 1 119 ALA n 1 120 SER n 1 121 VAL n 1 122 ALA n 1 123 ALA n 1 124 LEU n 1 125 THR n 1 126 ILE n 1 127 TYR n 1 128 ALA n 1 129 MET n 1 130 CYS n 1 131 LYS n 1 132 ALA n 1 133 VAL n 1 134 GLN n 1 135 LYS n 1 136 ASP n 1 137 MET n 1 138 VAL n 1 139 ILE n 1 140 GLY n 1 141 PRO n 1 142 VAL n 1 143 ARG n 1 144 LEU n 1 145 LEU n 1 146 ALA n 1 147 LYS n 1 148 SER n 1 149 GLY n 1 150 GLY n 1 151 LYS n 1 152 SER n 1 153 GLY n 1 154 ASP n 1 155 PHE n 1 156 LYS n 1 157 VAL n 1 158 GLU n 1 159 ALA n 1 160 ASP n 1 161 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location CYTOSOL _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PET 15B' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_code MOAC_ECOLI _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P0A738 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MSQLTHINAAGEAHMVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLM LSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSGGKSGDFKVEAD D ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1EKS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 161 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A738 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 161 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 161 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1EKS ALA A 2 ? UNP P0A738 SER 2 'engineered mutation' 2 1 1 1EKS ALA A 128 ? UNP P0A738 ASP 128 variant 128 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TLA non-polymer . 'L(+)-TARTARIC ACID' ? 'C4 H6 O6' 150.087 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1EKS _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 44.67 _exptl_crystal.density_Matthews 2.22 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.temp 295.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details 'Ammonium Phosphate, Sodium-Potassium Tartrate, Citrate, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 22K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 95 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 1998-07-23 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X26C' _diffrn_source.pdbx_wavelength 1.1 _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X26C _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1EKS _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 2.48 _reflns.number_obs 5826 _reflns.number_all 19808 _reflns.percent_possible_obs 0.971 _reflns.pdbx_Rmerge_I_obs 0.071 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 13.0 _reflns.B_iso_Wilson_estimate 50.7 _reflns.pdbx_redundancy 3.4 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.48 _reflns_shell.d_res_low 2.59 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 98.6 _reflns_shell.Rmerge_I_obs 0.516 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy 2.6 _reflns_shell.number_unique_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1EKS _refine.ls_number_reflns_obs 5098 _refine.ls_number_reflns_all 5665 _refine.pdbx_ls_sigma_I 0.0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 2.5 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2171 _refine.ls_R_factor_R_free 0.2759 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 567 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details 'Partial structure factors for bulk solvent were calculated in XPLOR and incorporated into REFMAC' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values Lamzin _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details Random _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1063 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 4 _refine_hist.number_atoms_total 1077 _refine_hist.d_res_high 2.5 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? p_angle_d 0.030 ? ? ? 'X-RAY DIFFRACTION' ? 'planar groups (peptides)' 0.0160 ? ? ? 'X-RAY DIFFRACTION' ? 'planar groups (aromatics)' 0.0067 ? ? ? 'X-RAY DIFFRACTION' ? 'chiral volumes' 0.109 ? ? ? 'X-RAY DIFFRACTION' ? 'torsion angles (planar)' 3.3 ? ? ? 'X-RAY DIFFRACTION' ? 'torsion angles (staggered)' 21.4 ? ? ? 'X-RAY DIFFRACTION' ? 'torsion angles (orthonormal)' 26.1 ? ? ? 'X-RAY DIFFRACTION' ? 'B-factors (main chain bond)' 3.00 ? ? ? 'X-RAY DIFFRACTION' ? 'B-factors (main chain angle)' 4.84 ? ? ? 'X-RAY DIFFRACTION' ? 'B-factors (side chain bond)' 3.32 ? ? ? 'X-RAY DIFFRACTION' ? 'B-factors (side chain angle)' 5.40 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1EKS _struct.title 'ASP128ALA VARIANT OF MOAC PROTEIN FROM E. COLI' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1EKS _struct_keywords.pdbx_keywords TRANSLATION _struct_keywords.text 'MoaC, Molybdenum cofactor (Moco), Moco biosynthesis, Moco deficiency, TRANSLATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details 'The biological assembly is a hexamer with 32 symmetry generated from chain A by crystallographic symmetry operations' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 37 ? ARG A 48 ? ARG A 37 ARG A 48 1 ? 12 HELX_P HELX_P2 2 ASP A 53 ? ARG A 68 ? ASP A 53 ARG A 68 1 ? 16 HELX_P HELX_P3 3 ARG A 68 ? ILE A 73 ? ARG A 68 ILE A 73 1 ? 6 HELX_P HELX_P4 4 PRO A 92 ? HIS A 94 ? PRO A 92 HIS A 94 5 ? 3 HELX_P HELX_P5 5 GLU A 112 ? LYS A 131 ? GLU A 112 LYS A 131 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASP 46 A . ? ASP 46 A GLY 47 A ? GLY 47 A 1 0.34 2 GLY 140 A . ? GLY 140 A PRO 141 A ? PRO 141 A 1 -2.84 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 83 ? GLU A 91 ? LYS A 83 GLU A 91 A 2 ARG A 96 ? THR A 106 ? ARG A 96 THR A 106 A 3 VAL A 25 ? THR A 35 ? VAL A 25 THR A 35 A 4 VAL A 138 ? ILE A 139 ? VAL A 138 ILE A 139 B 1 LYS A 83 ? GLU A 91 ? LYS A 83 GLU A 91 B 2 ARG A 96 ? THR A 106 ? ARG A 96 THR A 106 B 3 VAL A 25 ? THR A 35 ? VAL A 25 THR A 35 B 4 ARG A 143 ? LYS A 147 ? ARG A 143 LYS A 147 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 91 ? N GLU A 91 O ARG A 96 ? O ARG A 96 A 2 3 O LEU A 105 ? O LEU A 105 N ARG A 26 ? N ARG A 26 A 3 4 N THR A 35 ? N THR A 35 O VAL A 138 ? O VAL A 138 B 1 2 N GLU A 91 ? N GLU A 91 O ARG A 96 ? O ARG A 96 B 2 3 O LEU A 105 ? O LEU A 105 N ARG A 26 ? N ARG A 26 B 3 4 N GLU A 31 ? N GLU A 31 O ARG A 143 ? O ARG A 143 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id TLA _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 7 _struct_site.details 'BINDING SITE FOR RESIDUE TLA A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 LEU A 75 ? LEU A 75 . ? 1_555 ? 2 AC1 7 CYS A 76 ? CYS A 76 . ? 1_555 ? 3 AC1 7 HIS A 77 ? HIS A 77 . ? 1_555 ? 4 AC1 7 THR A 109 ? THR A 109 . ? 1_555 ? 5 AC1 7 LYS A 131 ? LYS A 131 . ? 10_666 ? 6 AC1 7 HOH C . ? HOH A 202 . ? 1_555 ? 7 AC1 7 HOH C . ? HOH A 204 . ? 1_555 ? # _database_PDB_matrix.entry_id 1EKS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1EKS _atom_sites.fract_transf_matrix[1][1] 0.01085 _atom_sites.fract_transf_matrix[1][2] 0.00627 _atom_sites.fract_transf_matrix[1][3] 0.00000 _atom_sites.fract_transf_matrix[2][1] 0.00000 _atom_sites.fract_transf_matrix[2][2] 0.01253 _atom_sites.fract_transf_matrix[2][3] 0.00000 _atom_sites.fract_transf_matrix[3][1] 0.00000 _atom_sites.fract_transf_matrix[3][2] 0.00000 _atom_sites.fract_transf_matrix[3][3] 0.01580 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 LEU 4 4 ? ? ? A . n A 1 5 THR 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 ILE 7 7 ? ? ? A . n A 1 8 ASN 8 8 ? ? ? A . n A 1 9 ALA 9 9 ? ? ? A . n A 1 10 ALA 10 10 ? ? ? A . n A 1 11 GLY 11 11 ? ? ? A . n A 1 12 GLU 12 12 ? ? ? A . n A 1 13 ALA 13 13 ? ? ? A . n A 1 14 HIS 14 14 ? ? ? A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ASP 17 17 17 ASP ASN A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 TRP 70 70 70 TRP TRP A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 CYS 103 103 103 CYS CYS A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 MET 113 113 113 MET MET A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 MET 129 129 129 MET MET A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 GLN 134 134 134 GLN GLN A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 MET 137 137 137 MET MET A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 GLY 149 149 ? ? ? A . n A 1 150 GLY 150 150 ? ? ? A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 LYS 156 156 156 LYS ALA A . n A 1 157 VAL 157 157 ? ? ? A . n A 1 158 GLU 158 158 ? ? ? A . n A 1 159 ALA 159 159 ? ? ? A . n A 1 160 ASP 160 160 ? ? ? A . n A 1 161 ASP 161 161 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 TLA 1 201 201 TLA TAR A . C 3 HOH 1 202 202 HOH WAT A . C 3 HOH 2 203 203 HOH WAT A . C 3 HOH 3 204 204 HOH WAT A . C 3 HOH 4 205 205 HOH WAT A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 19590 ? 1 MORE -105 ? 1 'SSA (A^2)' 31610 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -y+1,x-y,z -0.5000000000 -0.8660254038 0.0000000000 92.1280000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038 0.0000000000 46.0640000000 -0.8660254038 -0.5000000000 0.0000000000 79.7851883999 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 10_666 -y+1,-x+1,-z+3/2 0.5000000000 -0.8660254038 0.0000000000 46.0640000000 -0.8660254038 -0.5000000000 0.0000000000 79.7851883999 0.0000000000 0.0000000000 -1.0000000000 94.9335000000 5 'crystal symmetry operation' 11_656 -x+y+1,y,-z+3/2 -1.0000000000 0.0000000000 0.0000000000 92.1280000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 94.9335000000 6 'crystal symmetry operation' 12_556 x,x-y,-z+3/2 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 94.9335000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-09-20 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-04 5 'Structure model' 1 4 2018-01-31 6 'Structure model' 1 5 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' 5 5 'Structure model' 'Experimental preparation' 6 6 'Structure model' 'Database references' 7 6 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' exptl_crystal_grow 3 6 'Structure model' database_2 4 6 'Structure model' struct_ref_seq_dif 5 6 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_exptl_crystal_grow.temp' 2 6 'Structure model' '_database_2.pdbx_DOI' 3 6 'Structure model' '_database_2.pdbx_database_accession' 4 6 'Structure model' '_struct_ref_seq_dif.details' 5 6 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 6 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 6 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement . ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 17 ? ? CG A ASP 17 ? ? OD1 A ASP 17 ? ? 123.74 118.30 5.44 0.90 N 2 1 NE A ARG 37 ? ? CZ A ARG 37 ? ? NH1 A ARG 37 ? ? 125.52 120.30 5.22 0.50 N 3 1 NE A ARG 37 ? ? CZ A ARG 37 ? ? NH2 A ARG 37 ? ? 114.87 120.30 -5.43 0.50 N 4 1 CA A ASP 46 ? ? C A ASP 46 ? ? N A GLY 47 ? ? 129.78 116.20 13.58 2.00 Y 5 1 O A ASP 46 ? ? C A ASP 46 ? ? N A GLY 47 ? ? 112.01 123.20 -11.19 1.70 Y 6 1 C A ASP 46 ? ? N A GLY 47 ? ? CA A GLY 47 ? ? 139.29 122.30 16.99 2.10 Y 7 1 NE A ARG 68 ? ? CZ A ARG 68 ? ? NH1 A ARG 68 ? ? 115.77 120.30 -4.53 0.50 N 8 1 CA A LEU 79 ? ? CB A LEU 79 ? ? CG A LEU 79 ? ? 131.14 115.30 15.84 2.30 N 9 1 CA A GLU 91 ? ? CB A GLU 91 ? ? CG A GLU 91 ? ? 127.40 113.40 14.00 2.20 N 10 1 NE A ARG 96 ? ? CZ A ARG 96 ? ? NH2 A ARG 96 ? ? 116.72 120.30 -3.58 0.50 N 11 1 NE A ARG 98 ? ? CZ A ARG 98 ? ? NH1 A ARG 98 ? ? 124.46 120.30 4.16 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 20 ? ? -71.23 -93.03 2 1 GLU A 23 ? ? 81.00 104.14 3 1 HIS A 50 ? ? -114.35 -117.18 4 1 LYS A 51 ? ? -98.49 -62.89 5 1 VAL A 133 ? ? -78.47 -70.54 6 1 ASP A 136 ? ? -98.88 33.53 7 1 SER A 152 ? ? -93.48 -63.30 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 156 ? CG ? A LYS 156 CG 2 1 Y 1 A LYS 156 ? CD ? A LYS 156 CD 3 1 Y 1 A LYS 156 ? CE ? A LYS 156 CE 4 1 Y 1 A LYS 156 ? NZ ? A LYS 156 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A LEU 4 ? A LEU 4 5 1 Y 1 A THR 5 ? A THR 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A ILE 7 ? A ILE 7 8 1 Y 1 A ASN 8 ? A ASN 8 9 1 Y 1 A ALA 9 ? A ALA 9 10 1 Y 1 A ALA 10 ? A ALA 10 11 1 Y 1 A GLY 11 ? A GLY 11 12 1 Y 1 A GLU 12 ? A GLU 12 13 1 Y 1 A ALA 13 ? A ALA 13 14 1 Y 1 A HIS 14 ? A HIS 14 15 1 Y 1 A GLY 149 ? A GLY 149 16 1 Y 1 A GLY 150 ? A GLY 150 17 1 Y 1 A VAL 157 ? A VAL 157 18 1 Y 1 A GLU 158 ? A GLU 158 19 1 Y 1 A ALA 159 ? A ALA 159 20 1 Y 1 A ASP 160 ? A ASP 160 21 1 Y 1 A ASP 161 ? A ASP 161 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'L(+)-TARTARIC ACID' TLA 3 water HOH #