data_1EKT # _entry.id 1EKT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1EKT RCSB RCSB010685 WWPDB D_1000010685 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.pdb_id 1Z0R _pdbx_database_PDB_obs_spr.replace_pdb_id 1EKT _pdbx_database_PDB_obs_spr.date 2005-03-15 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.entry_id 1EKT _pdbx_database_status.recvd_initial_deposition_date 2000-03-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Vaughn, J.L.' 1 'Feher, V.' 2 'Naylor, S.' 3 'Strauch, M.A.' 4 'Cavanagh, J.' 5 # _citation.id primary _citation.title 'Novel DNA binding domain and genetic regulation model of Bacillus subtilis transition state regulator abrB.' _citation.journal_abbrev Nat.Struct.Biol. _citation.journal_volume 7 _citation.page_first 1139 _citation.page_last 1146 _citation.year 2000 _citation.journal_id_ASTM NSBIEW _citation.country US _citation.journal_id_ISSN 1072-8368 _citation.journal_id_CSD 2024 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11101897 _citation.pdbx_database_id_DOI 10.1038/81999 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Vaughn, J.L.' 1 primary 'Feher, V.' 2 primary 'Naylor, S.' 3 primary 'Strauch, M.A.' 4 primary 'Cavanagh, J.' 5 # _cell.entry_id 1EKT _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1EKT _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TRANSCRIPTION STATE REGULATORY PROTEIN ABRB' _entity.formula_weight 6111.287 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-TERMINAL DIMER FROM RESIDUES 1-53 (OF 94)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT _entity_poly.pdbx_seq_one_letter_code_can MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 SER n 1 4 THR n 1 5 GLY n 1 6 ILE n 1 7 VAL n 1 8 ARG n 1 9 LYS n 1 10 VAL n 1 11 ASP n 1 12 GLU n 1 13 LEU n 1 14 GLY n 1 15 ARG n 1 16 VAL n 1 17 VAL n 1 18 ILE n 1 19 PRO n 1 20 ILE n 1 21 GLU n 1 22 LEU n 1 23 ARG n 1 24 ARG n 1 25 THR n 1 26 LEU n 1 27 GLY n 1 28 ILE n 1 29 ALA n 1 30 GLU n 1 31 LYS n 1 32 ASP n 1 33 ALA n 1 34 LEU n 1 35 GLU n 1 36 ILE n 1 37 TYR n 1 38 VAL n 1 39 ASP n 1 40 ASP n 1 41 GLU n 1 42 LYS n 1 43 ILE n 1 44 ILE n 1 45 LEU n 1 46 LYS n 1 47 LYS n 1 48 TYR n 1 49 LYS n 1 50 PRO n 1 51 ASN n 1 52 MET n 1 53 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name BACTERIA _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ABRB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'BACILLUS SUBTILIS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name bacteria _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-24 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_code ABRB_BACSU _struct_ref.db_name SWS _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P08874 _struct_ref.pdbx_align_begin 3 _struct_ref.pdbx_seq_one_letter_code MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1EKT A 1 ? 53 ? P08874 3 ? 55 ? 1 53 2 1 1EKT B 1 ? 53 ? P08874 3 ? 55 ? 1 53 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY 3 1 1 HNHA 4 1 1 HNHB 5 1 1 '3-D 15N TOCSY' 6 1 1 '3-D 13C sequential assignment protocols' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 305 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1-2mM AbrBN53; >95% pure; 20 mM phosphate buffer pH 5.8, 15 mM KCl, 0.1 mM MgCl2, 1 mM EDTA' _pdbx_nmr_sample_details.solvent_system '5% D2O, 95% H2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 500 2 ? Bruker DMX 600 # _pdbx_nmr_refine.entry_id 1EKT _pdbx_nmr_refine.method 'Embedding, distance geometry/simulated annealing/ molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1EKT _pdbx_nmr_details.text 'Structure was determined with a variety of 15N and 13C/15N edited standard NMR techniques' # _pdbx_nmr_ensemble.entry_id 1EKT _pdbx_nmr_ensemble.conformers_calculated_total_number 53 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1EKT _pdbx_nmr_representative.conformer_id 2 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal FELIX 95,97 processing MSI 1 FELIX 95,97 'data analysis' MSI 2 INSIGHT 97,98 'structure solution' MSI 3 X-PLOR 3.0 refinement 'Brunger, 1993' 4 X-PLOR 3.0 'structure solution' 'Brunger 1993' 5 # _exptl.entry_id 1EKT _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1EKT _struct.title 'SOLUTION STRUCTURE OF THE N-TERMINAL DNA RECOGNITION DOMAIN OF THE BACILLUS SUBTILIS TRANSCRIPTION-STATE REGULATOR ABRB' _struct.pdbx_descriptor 'TRANSCRIPTION STATE REGULATORY PROTEIN ABRB' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1EKT _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'Novel DNA recognition topology, TRANSCRIPTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 19 ? GLY A 27 ? PRO A 19 GLY A 27 1 ? 9 HELX_P HELX_P2 2 PRO B 19 ? GLY B 27 ? PRO B 19 GLY B 27 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 6 ? ARG A 8 ? ILE A 6 ARG A 8 A 2 LEU A 34 ? ASP A 39 ? LEU A 34 ASP A 39 A 3 LYS A 42 ? LYS A 47 ? LYS A 42 LYS A 47 A 4 LYS B 42 ? LYS B 47 ? LYS B 42 LYS B 47 A 5 LEU B 34 ? ASP B 39 ? LEU B 34 ASP B 39 A 6 ILE B 6 ? ARG B 8 ? ILE B 6 ARG B 8 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 8 ? N ARG A 8 O LEU A 34 ? O LEU A 34 A 2 3 O ASP A 39 ? O ASP A 39 N LYS A 42 ? N LYS A 42 A 3 4 N LEU A 45 ? N LEU A 45 O ILE B 43 ? O ILE B 43 A 4 5 O LYS B 46 ? O LYS B 46 N GLU B 35 ? N GLU B 35 A 5 6 N ILE B 36 ? N ILE B 36 O ILE B 6 ? O ILE B 6 # _database_PDB_matrix.entry_id 1EKT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1EKT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 THR 53 53 53 THR THR A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 LYS 2 2 2 LYS LYS B . n B 1 3 SER 3 3 3 SER SER B . n B 1 4 THR 4 4 4 THR THR B . n B 1 5 GLY 5 5 5 GLY GLY B . n B 1 6 ILE 6 6 6 ILE ILE B . n B 1 7 VAL 7 7 7 VAL VAL B . n B 1 8 ARG 8 8 8 ARG ARG B . n B 1 9 LYS 9 9 9 LYS LYS B . n B 1 10 VAL 10 10 10 VAL VAL B . n B 1 11 ASP 11 11 11 ASP ASP B . n B 1 12 GLU 12 12 12 GLU GLU B . n B 1 13 LEU 13 13 13 LEU LEU B . n B 1 14 GLY 14 14 14 GLY GLY B . n B 1 15 ARG 15 15 15 ARG ARG B . n B 1 16 VAL 16 16 16 VAL VAL B . n B 1 17 VAL 17 17 17 VAL VAL B . n B 1 18 ILE 18 18 18 ILE ILE B . n B 1 19 PRO 19 19 19 PRO PRO B . n B 1 20 ILE 20 20 20 ILE ILE B . n B 1 21 GLU 21 21 21 GLU GLU B . n B 1 22 LEU 22 22 22 LEU LEU B . n B 1 23 ARG 23 23 23 ARG ARG B . n B 1 24 ARG 24 24 24 ARG ARG B . n B 1 25 THR 25 25 25 THR THR B . n B 1 26 LEU 26 26 26 LEU LEU B . n B 1 27 GLY 27 27 27 GLY GLY B . n B 1 28 ILE 28 28 28 ILE ILE B . n B 1 29 ALA 29 29 29 ALA ALA B . n B 1 30 GLU 30 30 30 GLU GLU B . n B 1 31 LYS 31 31 31 LYS LYS B . n B 1 32 ASP 32 32 32 ASP ASP B . n B 1 33 ALA 33 33 33 ALA ALA B . n B 1 34 LEU 34 34 34 LEU LEU B . n B 1 35 GLU 35 35 35 GLU GLU B . n B 1 36 ILE 36 36 36 ILE ILE B . n B 1 37 TYR 37 37 37 TYR TYR B . n B 1 38 VAL 38 38 38 VAL VAL B . n B 1 39 ASP 39 39 39 ASP ASP B . n B 1 40 ASP 40 40 40 ASP ASP B . n B 1 41 GLU 41 41 41 GLU GLU B . n B 1 42 LYS 42 42 42 LYS LYS B . n B 1 43 ILE 43 43 43 ILE ILE B . n B 1 44 ILE 44 44 44 ILE ILE B . n B 1 45 LEU 45 45 45 LEU LEU B . n B 1 46 LYS 46 46 46 LYS LYS B . n B 1 47 LYS 47 47 47 LYS LYS B . n B 1 48 TYR 48 48 48 TYR TYR B . n B 1 49 LYS 49 49 49 LYS LYS B . n B 1 50 PRO 50 50 50 PRO PRO B . n B 1 51 ASN 51 51 51 ASN ASN B . n B 1 52 MET 52 52 52 MET MET B . n B 1 53 THR 53 53 53 THR THR B . n # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-12-13 2 'Structure model' 1 1 2005-03-15 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A GLU 35 ? ? O A LYS 46 ? ? 1.45 2 1 H B GLU 35 ? ? O B LYS 46 ? ? 1.48 3 1 O B PRO 19 ? ? H B LEU 22 ? ? 1.59 4 2 H B GLU 35 ? ? O B LYS 46 ? ? 1.44 5 2 H A GLU 35 ? ? O A LYS 46 ? ? 1.46 6 3 O B ARG 23 ? ? H B GLY 27 ? ? 1.43 7 3 H A GLU 35 ? ? O A LYS 46 ? ? 1.45 8 3 H B GLU 35 ? ? O B LYS 46 ? ? 1.45 9 3 O B PRO 19 ? ? H B LEU 22 ? ? 1.55 10 4 H A GLU 35 ? ? O A LYS 46 ? ? 1.45 11 4 H B GLU 35 ? ? O B LYS 46 ? ? 1.46 12 4 O A PRO 19 ? ? H A LEU 22 ? ? 1.59 13 5 H A GLU 35 ? ? O A LYS 46 ? ? 1.44 14 5 O B ARG 23 ? ? H B GLY 27 ? ? 1.48 15 5 H B GLU 35 ? ? O B LYS 46 ? ? 1.50 16 5 O B PRO 19 ? ? H B LEU 22 ? ? 1.52 17 5 OD1 A ASP 11 ? ? H A LEU 13 ? ? 1.55 18 6 H A GLU 35 ? ? O A LYS 46 ? ? 1.44 19 6 H B GLU 35 ? ? O B LYS 46 ? ? 1.45 20 6 O A PRO 19 ? ? H A LEU 22 ? ? 1.59 21 7 H A GLU 35 ? ? O A LYS 46 ? ? 1.44 22 7 H B GLU 35 ? ? O B LYS 46 ? ? 1.44 23 7 OD2 A ASP 39 ? ? 3HZ A LYS 42 ? ? 1.59 24 8 H A GLU 35 ? ? O A LYS 46 ? ? 1.44 25 8 H B GLU 35 ? ? O B LYS 46 ? ? 1.45 26 8 HG1 A THR 4 ? ? O A ILE 36 ? ? 1.55 27 8 OE1 A GLU 41 ? ? 1HZ B LYS 49 ? ? 1.56 28 9 H B GLU 35 ? ? O B LYS 46 ? ? 1.45 29 9 H A GLU 35 ? ? O A LYS 46 ? ? 1.45 30 10 H A GLU 35 ? ? O A LYS 46 ? ? 1.46 31 10 H B GLU 35 ? ? O B LYS 46 ? ? 1.48 32 10 O B PRO 19 ? ? H B LEU 22 ? ? 1.59 33 11 H B GLU 35 ? ? O B LYS 46 ? ? 1.45 34 11 H A GLU 35 ? ? O A LYS 46 ? ? 1.48 35 11 O A GLU 21 ? ? HG1 A THR 25 ? ? 1.49 36 11 O A PRO 19 ? ? H A LEU 22 ? ? 1.57 37 11 O B PRO 50 ? ? H B MET 52 ? ? 1.57 38 12 H A GLU 35 ? ? O A LYS 46 ? ? 1.44 39 12 H B GLU 35 ? ? O B LYS 46 ? ? 1.44 40 13 H A GLU 35 ? ? O A LYS 46 ? ? 1.45 41 13 H B GLU 35 ? ? O B LYS 46 ? ? 1.45 42 13 O A PRO 19 ? ? H A LEU 22 ? ? 1.56 43 14 H A GLU 35 ? ? O A LYS 46 ? ? 1.45 44 14 H B GLU 35 ? ? O B LYS 46 ? ? 1.45 45 14 HG1 B THR 4 ? ? O B ILE 36 ? ? 1.53 46 14 O B PRO 19 ? ? H B LEU 22 ? ? 1.59 47 15 H B GLU 35 ? ? O B LYS 46 ? ? 1.45 48 15 H A GLU 35 ? ? O A LYS 46 ? ? 1.45 49 15 O B PRO 19 ? ? H B LEU 22 ? ? 1.52 50 15 O A PRO 19 ? ? H A LEU 22 ? ? 1.59 51 16 H B GLU 35 ? ? O B LYS 46 ? ? 1.45 52 16 H A GLU 35 ? ? O A LYS 46 ? ? 1.45 53 17 HG1 A THR 4 ? ? O A ILE 36 ? ? 1.55 54 17 O A PRO 19 ? ? H A LEU 22 ? ? 1.58 55 18 H B GLU 35 ? ? O B LYS 46 ? ? 1.44 56 18 H A GLU 35 ? ? O A LYS 46 ? ? 1.45 57 19 H B GLU 35 ? ? O B LYS 46 ? ? 1.46 58 19 H A GLU 35 ? ? O A LYS 46 ? ? 1.46 59 19 HG1 A THR 4 ? ? O A ILE 36 ? ? 1.53 60 19 O B PRO 19 ? ? H B LEU 22 ? ? 1.58 61 20 H B GLU 35 ? ? O B LYS 46 ? ? 1.49 62 20 OE2 B GLU 35 ? ? 1HZ B LYS 46 ? ? 1.52 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? -59.27 -156.31 2 1 VAL A 10 ? ? -59.00 -152.32 3 1 ASP A 11 ? ? -150.17 -152.35 4 1 VAL A 17 ? ? 37.39 30.88 5 1 ALA A 29 ? ? -115.82 -163.64 6 1 GLU A 30 ? ? -69.51 -169.24 7 1 LYS A 31 ? ? -39.33 93.51 8 1 ASP A 32 ? ? -151.07 68.24 9 1 ASP A 40 ? ? 56.53 -91.56 10 1 GLU A 41 ? ? -155.63 20.20 11 1 ASN A 51 ? ? -96.86 33.50 12 1 MET A 52 ? ? -108.57 69.76 13 1 SER B 3 ? ? -65.00 -175.15 14 1 VAL B 10 ? ? -62.58 -154.71 15 1 ASP B 11 ? ? -150.13 -144.77 16 1 VAL B 17 ? ? 37.50 30.70 17 1 ALA B 29 ? ? -111.09 -154.87 18 1 LYS B 31 ? ? -33.48 93.05 19 1 ASP B 40 ? ? 56.12 -84.38 20 1 GLU B 41 ? ? -166.46 26.15 21 1 LYS B 47 ? ? -39.67 138.83 22 1 ASN B 51 ? ? -104.63 55.73 23 1 MET B 52 ? ? -104.48 78.89 24 2 SER A 3 ? ? -64.12 -142.57 25 2 VAL A 10 ? ? -63.75 -151.54 26 2 ASP A 11 ? ? -150.24 -150.22 27 2 VAL A 17 ? ? 37.39 30.54 28 2 PRO A 19 ? ? -64.59 99.63 29 2 ALA A 29 ? ? -112.03 -142.28 30 2 LYS A 31 ? ? -30.88 92.83 31 2 ASP A 40 ? ? 51.96 -94.67 32 2 GLU A 41 ? ? -150.77 17.44 33 2 MET A 52 ? ? -54.19 172.21 34 2 LYS B 2 ? ? -174.15 119.11 35 2 SER B 3 ? ? -62.30 -148.05 36 2 VAL B 10 ? ? -71.85 -152.81 37 2 ASP B 11 ? ? -150.14 -147.65 38 2 VAL B 17 ? ? 37.58 31.03 39 2 PRO B 19 ? ? -63.82 93.62 40 2 ALA B 29 ? ? -123.75 -148.94 41 2 LYS B 31 ? ? -37.24 92.56 42 2 ASP B 40 ? ? 47.50 -91.14 43 2 GLU B 41 ? ? -153.59 18.02 44 2 LYS B 47 ? ? -39.82 142.96 45 2 TYR B 48 ? ? -56.44 96.76 46 2 MET B 52 ? ? -177.61 130.45 47 3 SER A 3 ? ? -63.02 -143.88 48 3 ASP A 11 ? ? -103.10 -154.94 49 3 VAL A 16 ? ? -113.68 64.32 50 3 VAL A 17 ? ? 37.57 31.15 51 3 PRO A 19 ? ? -64.71 98.76 52 3 GLU A 21 ? ? -39.80 -31.73 53 3 ALA A 29 ? ? -114.66 -168.40 54 3 GLU A 30 ? ? -69.26 -164.18 55 3 LYS A 31 ? ? -29.15 94.12 56 3 ASP A 40 ? ? 55.78 -89.18 57 3 GLU A 41 ? ? -157.31 18.13 58 3 TYR A 48 ? ? -55.32 97.10 59 3 MET A 52 ? ? -174.90 104.58 60 3 SER B 3 ? ? -64.13 -142.02 61 3 VAL B 10 ? ? -71.09 -152.44 62 3 ASP B 11 ? ? -150.13 -147.91 63 3 VAL B 17 ? ? 37.23 34.73 64 3 PRO B 19 ? ? -62.98 96.77 65 3 ALA B 29 ? ? -113.86 -151.34 66 3 LYS B 31 ? ? -35.05 92.89 67 3 ASP B 40 ? ? 53.52 -88.50 68 3 GLU B 41 ? ? -158.02 19.93 69 3 LYS B 47 ? ? -39.68 138.42 70 3 TYR B 48 ? ? -46.32 109.94 71 4 SER A 3 ? ? -67.35 -165.45 72 4 VAL A 10 ? ? -58.31 -154.94 73 4 ASP A 11 ? ? -150.14 -149.59 74 4 VAL A 17 ? ? 37.62 30.89 75 4 ALA A 29 ? ? -113.48 -150.36 76 4 GLU A 30 ? ? -78.40 -165.72 77 4 LYS A 31 ? ? -36.50 94.02 78 4 ASP A 40 ? ? 48.59 -134.60 79 4 VAL B 10 ? ? -61.07 -153.05 80 4 ASP B 11 ? ? -150.18 -146.96 81 4 VAL B 16 ? ? -116.41 62.95 82 4 VAL B 17 ? ? 37.37 30.77 83 4 GLU B 21 ? ? -39.99 -28.82 84 4 ALA B 29 ? ? -108.07 -144.00 85 4 LYS B 31 ? ? -36.11 92.82 86 4 ASP B 40 ? ? 44.57 -92.18 87 4 GLU B 41 ? ? -148.94 18.40 88 4 LYS B 47 ? ? -41.24 153.35 89 4 MET B 52 ? ? -69.44 -75.22 90 5 SER A 3 ? ? -59.68 -161.35 91 5 VAL A 10 ? ? -66.30 -159.08 92 5 ASP A 11 ? ? -150.34 -152.56 93 5 VAL A 16 ? ? -111.64 63.40 94 5 VAL A 17 ? ? 37.43 31.25 95 5 ALA A 29 ? ? -103.73 -142.58 96 5 LYS A 31 ? ? -38.99 94.26 97 5 ASP A 40 ? ? 55.98 -85.17 98 5 GLU A 41 ? ? -165.34 22.54 99 5 LYS A 47 ? ? -39.75 144.44 100 5 LYS B 2 ? ? -106.15 -152.49 101 5 SER B 3 ? ? -44.11 169.98 102 5 VAL B 10 ? ? -68.17 -158.48 103 5 ASP B 11 ? ? -150.28 -150.80 104 5 VAL B 17 ? ? 37.29 30.82 105 5 PRO B 19 ? ? -63.57 95.58 106 5 ALA B 29 ? ? -110.73 -161.66 107 5 GLU B 30 ? ? -71.74 -164.49 108 5 LYS B 31 ? ? -34.36 94.29 109 5 ASP B 40 ? ? 50.05 -92.86 110 5 GLU B 41 ? ? -150.70 17.15 111 5 TYR B 48 ? ? -41.98 103.25 112 5 MET B 52 ? ? -56.53 -70.69 113 6 SER A 3 ? ? -61.32 -143.48 114 6 VAL A 10 ? ? -64.40 -153.56 115 6 ASP A 11 ? ? -150.25 -143.80 116 6 VAL A 16 ? ? -114.40 65.02 117 6 VAL A 17 ? ? 37.56 30.90 118 6 PRO A 19 ? ? -63.84 98.09 119 6 ALA A 29 ? ? -119.00 -144.73 120 6 LYS A 31 ? ? -37.57 92.63 121 6 ASP A 40 ? ? 49.16 -90.12 122 6 GLU A 41 ? ? -155.02 19.76 123 6 LYS A 47 ? ? -39.79 138.90 124 6 TYR A 48 ? ? -45.14 102.45 125 6 ASN A 51 ? ? -83.13 48.45 126 6 LYS B 2 ? ? -179.54 132.65 127 6 SER B 3 ? ? -60.04 -144.50 128 6 VAL B 10 ? ? -78.26 -155.19 129 6 ASP B 11 ? ? -150.02 -152.55 130 6 VAL B 17 ? ? 37.13 30.30 131 6 PRO B 19 ? ? -64.84 99.45 132 6 ALA B 29 ? ? -140.71 -157.28 133 6 GLU B 30 ? ? -75.73 -165.31 134 6 LYS B 31 ? ? -42.80 92.79 135 6 ASP B 32 ? ? -151.35 65.44 136 6 ASP B 40 ? ? 53.45 -92.10 137 6 GLU B 41 ? ? -154.07 19.30 138 6 MET B 52 ? ? -99.43 30.87 139 7 LYS A 2 ? ? -167.63 56.76 140 7 SER A 3 ? ? -60.30 -140.72 141 7 VAL A 10 ? ? -66.90 -150.07 142 7 ASP A 11 ? ? -150.03 -148.62 143 7 VAL A 16 ? ? -101.67 66.45 144 7 VAL A 17 ? ? 37.73 31.04 145 7 PRO A 19 ? ? -63.60 97.08 146 7 ALA A 29 ? ? -114.78 -149.11 147 7 LYS A 31 ? ? -33.96 92.64 148 7 ASP A 40 ? ? 44.46 -133.31 149 7 TYR A 48 ? ? -41.68 95.61 150 7 MET A 52 ? ? -179.00 -56.80 151 7 SER B 3 ? ? -60.91 -143.92 152 7 VAL B 10 ? ? -90.69 -157.87 153 7 VAL B 17 ? ? 37.59 30.59 154 7 ALA B 29 ? ? -118.38 -167.54 155 7 GLU B 30 ? ? -68.67 -172.88 156 7 LYS B 31 ? ? -39.48 92.99 157 7 ALA B 33 ? ? -39.95 123.66 158 7 ASP B 40 ? ? 43.32 -93.00 159 7 GLU B 41 ? ? -150.52 16.94 160 8 LYS A 2 ? ? 61.08 127.87 161 8 SER A 3 ? ? -39.05 157.02 162 8 VAL A 10 ? ? -56.87 -160.57 163 8 ASP A 11 ? ? -139.21 -149.89 164 8 VAL A 17 ? ? 37.65 30.95 165 8 PRO A 19 ? ? -65.79 99.87 166 8 ALA A 29 ? ? -113.28 -167.32 167 8 GLU A 30 ? ? -67.69 -168.54 168 8 LYS A 31 ? ? -34.36 93.56 169 8 ASP A 40 ? ? 52.34 -88.99 170 8 GLU A 41 ? ? -157.35 18.09 171 8 LYS A 47 ? ? -39.79 140.10 172 8 TYR A 48 ? ? -41.57 103.52 173 8 MET A 52 ? ? -161.65 23.66 174 8 SER B 3 ? ? -56.98 -157.31 175 8 ASP B 11 ? ? -99.04 -158.28 176 8 VAL B 17 ? ? 38.34 30.22 177 8 ALA B 29 ? ? -115.44 -158.83 178 8 GLU B 30 ? ? -90.36 -149.33 179 8 LYS B 31 ? ? -32.49 92.80 180 8 ASP B 32 ? ? -170.19 123.89 181 8 ASP B 40 ? ? 53.19 -97.76 182 8 GLU B 41 ? ? -145.38 13.83 183 8 LYS B 47 ? ? -39.32 145.18 184 8 TYR B 48 ? ? -55.81 102.95 185 9 SER A 3 ? ? -59.54 -143.07 186 9 VAL A 10 ? ? -78.88 -158.86 187 9 ASP A 11 ? ? -144.90 -153.10 188 9 VAL A 17 ? ? 37.45 30.11 189 9 ALA A 29 ? ? -127.85 -163.88 190 9 GLU A 30 ? ? -73.63 -169.90 191 9 LYS A 31 ? ? -40.49 92.81 192 9 ASP A 32 ? ? -150.28 69.69 193 9 ASP A 40 ? ? 58.13 -92.17 194 9 GLU A 41 ? ? -154.10 18.62 195 9 LYS B 2 ? ? -99.42 32.29 196 9 SER B 3 ? ? -59.86 -143.18 197 9 VAL B 10 ? ? -72.41 -163.85 198 9 ASP B 11 ? ? -150.67 -150.87 199 9 ARG B 15 ? ? -176.79 121.21 200 9 VAL B 17 ? ? 37.73 30.72 201 9 PRO B 19 ? ? -63.38 98.93 202 9 ALA B 29 ? ? -111.78 -142.98 203 9 LYS B 31 ? ? -38.62 94.39 204 9 ASP B 32 ? ? -151.01 71.89 205 9 ASP B 40 ? ? 50.55 -91.49 206 9 GLU B 41 ? ? -153.94 20.71 207 9 LYS B 47 ? ? -39.89 140.60 208 10 LYS A 2 ? ? -173.60 110.18 209 10 SER A 3 ? ? -62.82 -142.10 210 10 VAL A 17 ? ? 37.71 30.63 211 10 PRO A 19 ? ? -63.63 97.42 212 10 ALA A 29 ? ? -115.34 -160.64 213 10 GLU A 30 ? ? -74.20 -162.03 214 10 LYS A 31 ? ? -47.69 90.23 215 10 ALA A 33 ? ? -38.69 123.50 216 10 ASP A 40 ? ? 44.06 -130.79 217 10 TYR A 48 ? ? -53.72 99.42 218 10 MET A 52 ? ? -63.92 75.59 219 10 SER B 3 ? ? -63.63 -169.42 220 10 VAL B 17 ? ? 37.58 29.82 221 10 ALA B 29 ? ? -121.33 -158.72 222 10 GLU B 30 ? ? -75.10 -162.90 223 10 LYS B 31 ? ? -41.33 94.41 224 10 ASP B 32 ? ? -166.50 99.80 225 10 ASP B 40 ? ? 41.91 -115.84 226 10 LYS B 47 ? ? -39.78 151.98 227 10 LYS B 49 ? ? -111.94 -168.08 228 11 SER A 3 ? ? -57.91 -160.93 229 11 VAL A 10 ? ? -65.28 -158.89 230 11 ASP A 11 ? ? -150.21 -153.44 231 11 VAL A 17 ? ? 37.94 30.59 232 11 ALA A 29 ? ? -109.53 -143.29 233 11 LYS A 31 ? ? -36.55 93.63 234 11 ASP A 40 ? ? 44.97 -92.20 235 11 GLU A 41 ? ? -153.55 21.72 236 11 LYS A 47 ? ? -39.96 139.81 237 11 TYR A 48 ? ? -45.05 105.30 238 11 ASN A 51 ? ? -53.80 87.84 239 11 LYS B 2 ? ? 55.24 87.03 240 11 SER B 3 ? ? -60.75 -168.33 241 11 VAL B 10 ? ? -64.75 -158.21 242 11 ASP B 11 ? ? -144.01 -148.63 243 11 VAL B 17 ? ? 37.68 30.38 244 11 GLU B 30 ? ? -52.99 -172.93 245 11 LYS B 31 ? ? -36.16 92.85 246 11 ASP B 40 ? ? 50.74 -88.78 247 11 GLU B 41 ? ? -155.28 19.93 248 11 LYS B 47 ? ? -39.69 140.85 249 11 TYR B 48 ? ? -45.16 94.00 250 11 ASN B 51 ? ? -66.93 59.67 251 12 LYS A 2 ? ? -103.87 67.72 252 12 SER A 3 ? ? -59.52 -150.15 253 12 ASP A 11 ? ? -150.20 -157.77 254 12 VAL A 17 ? ? 37.61 30.25 255 12 GLU A 30 ? ? -62.30 -166.75 256 12 LYS A 31 ? ? -40.13 93.97 257 12 ASP A 32 ? ? -153.69 64.70 258 12 ASP A 40 ? ? 46.71 -103.80 259 12 TYR A 48 ? ? -41.82 109.09 260 12 MET A 52 ? ? -175.31 52.57 261 12 SER B 3 ? ? -74.89 -166.70 262 12 VAL B 10 ? ? -63.28 -153.69 263 12 ASP B 11 ? ? -150.07 -149.32 264 12 VAL B 17 ? ? 37.80 30.91 265 12 ALA B 29 ? ? -110.75 -157.72 266 12 GLU B 30 ? ? -72.94 -169.03 267 12 LYS B 31 ? ? -36.16 93.16 268 12 ASP B 40 ? ? 52.12 -99.67 269 12 GLU B 41 ? ? -145.25 21.66 270 12 LYS B 47 ? ? -39.76 140.57 271 13 LYS A 2 ? ? 179.55 125.71 272 13 SER A 3 ? ? -59.10 -146.77 273 13 VAL A 10 ? ? -71.96 -151.99 274 13 ASP A 11 ? ? -150.21 -148.72 275 13 VAL A 17 ? ? 37.63 30.78 276 13 PRO A 19 ? ? -63.53 98.57 277 13 ALA A 29 ? ? -113.29 -155.24 278 13 GLU A 30 ? ? -76.74 -169.20 279 13 LYS A 31 ? ? -35.95 93.19 280 13 ASP A 40 ? ? 55.03 -85.53 281 13 GLU A 41 ? ? -163.52 24.44 282 13 SER B 3 ? ? -65.47 -142.49 283 13 VAL B 10 ? ? -64.25 -151.26 284 13 ASP B 11 ? ? -150.11 -149.92 285 13 VAL B 16 ? ? -106.75 65.08 286 13 VAL B 17 ? ? 37.59 30.84 287 13 PRO B 19 ? ? -64.26 94.37 288 13 ALA B 29 ? ? -123.19 -160.10 289 13 LYS B 31 ? ? -36.76 92.83 290 13 ASP B 40 ? ? 43.88 -129.78 291 13 TYR B 48 ? ? -41.73 104.91 292 14 LYS A 2 ? ? 65.69 167.17 293 14 SER A 3 ? ? -55.13 -164.75 294 14 VAL A 10 ? ? -57.23 -159.42 295 14 ASP A 11 ? ? -150.17 -148.79 296 14 VAL A 17 ? ? 37.11 30.72 297 14 ALA A 29 ? ? -109.91 -143.31 298 14 LYS A 31 ? ? -37.35 93.85 299 14 ASP A 40 ? ? 43.56 -134.68 300 14 LYS A 47 ? ? -40.00 143.03 301 14 TYR A 48 ? ? -49.32 107.68 302 14 LYS B 2 ? ? 65.89 63.24 303 14 SER B 3 ? ? -65.41 -158.18 304 14 VAL B 17 ? ? 37.48 30.80 305 14 ALA B 29 ? ? -126.68 -164.80 306 14 GLU B 30 ? ? -77.58 -152.41 307 14 LYS B 31 ? ? -37.58 94.33 308 14 ASP B 32 ? ? -162.02 75.16 309 14 ASP B 40 ? ? 52.51 -133.12 310 14 MET B 52 ? ? -174.03 -145.71 311 15 LYS A 2 ? ? 66.48 120.93 312 15 SER A 3 ? ? -71.83 -161.61 313 15 VAL A 10 ? ? -66.89 -153.62 314 15 ASP A 11 ? ? -150.05 -149.77 315 15 VAL A 17 ? ? 37.57 30.37 316 15 ALA A 29 ? ? -111.52 -150.58 317 15 LYS A 31 ? ? -31.06 91.45 318 15 ASP A 40 ? ? 52.57 -98.52 319 15 GLU A 41 ? ? -144.88 19.51 320 15 LYS A 47 ? ? -39.92 137.94 321 15 LYS B 2 ? ? 65.15 105.67 322 15 SER B 3 ? ? -59.92 -140.20 323 15 THR B 4 ? ? -118.17 50.21 324 15 VAL B 10 ? ? -67.85 -154.77 325 15 ASP B 11 ? ? -150.11 -144.31 326 15 VAL B 17 ? ? 37.56 30.42 327 15 PRO B 19 ? ? -63.50 99.39 328 15 ALA B 29 ? ? -119.59 -162.00 329 15 LYS B 31 ? ? -34.28 92.83 330 15 ASP B 40 ? ? 47.22 -132.36 331 15 TYR B 48 ? ? -50.16 99.34 332 16 SER A 3 ? ? -62.03 -143.05 333 16 VAL A 10 ? ? -68.48 -150.90 334 16 ASP A 11 ? ? -150.05 -147.45 335 16 VAL A 16 ? ? -104.64 64.90 336 16 VAL A 17 ? ? 37.67 30.82 337 16 PRO A 19 ? ? -63.67 99.24 338 16 ALA A 29 ? ? -116.45 -141.74 339 16 LYS A 31 ? ? -35.90 92.51 340 16 ASP A 40 ? ? 48.97 -99.46 341 16 TYR A 48 ? ? -54.85 107.68 342 16 MET A 52 ? ? -42.71 161.54 343 16 SER B 3 ? ? -60.11 -140.76 344 16 VAL B 10 ? ? -82.26 -157.91 345 16 ASP B 11 ? ? -146.78 -151.43 346 16 VAL B 17 ? ? 37.21 30.49 347 16 ALA B 29 ? ? -128.92 -166.00 348 16 GLU B 30 ? ? -69.85 -170.13 349 16 LYS B 31 ? ? -41.19 92.85 350 16 ASP B 32 ? ? -150.58 69.55 351 16 ASP B 40 ? ? 50.45 -91.99 352 16 GLU B 41 ? ? -153.01 19.50 353 17 SER A 3 ? ? -75.69 -162.34 354 17 VAL A 10 ? ? -60.64 -153.92 355 17 ASP A 11 ? ? -150.14 -148.13 356 17 VAL A 16 ? ? -117.21 62.66 357 17 VAL A 17 ? ? 37.62 31.11 358 17 PRO A 19 ? ? -64.72 96.44 359 17 ALA A 29 ? ? -115.71 -158.92 360 17 GLU A 30 ? ? -74.46 -167.69 361 17 LYS A 31 ? ? -37.94 93.25 362 17 ASP A 40 ? ? 58.55 -93.92 363 17 GLU A 41 ? ? -152.55 18.80 364 17 SER B 3 ? ? -49.35 -179.20 365 17 VAL B 10 ? ? -62.91 -152.19 366 17 ASP B 11 ? ? -150.16 -151.13 367 17 VAL B 17 ? ? 37.38 31.01 368 17 ALA B 29 ? ? -110.20 -137.97 369 17 LYS B 31 ? ? -34.51 92.52 370 17 ASP B 40 ? ? 50.85 -93.19 371 17 GLU B 41 ? ? -151.24 17.36 372 17 ASN B 51 ? ? -94.25 33.66 373 18 LYS A 2 ? ? -161.10 107.81 374 18 SER A 3 ? ? -59.42 -143.82 375 18 VAL A 10 ? ? -63.32 -153.20 376 18 ASP A 11 ? ? -150.22 -142.98 377 18 VAL A 16 ? ? -114.53 65.54 378 18 VAL A 17 ? ? 37.26 30.99 379 18 PRO A 19 ? ? -64.70 99.47 380 18 ALA A 29 ? ? -117.70 -143.53 381 18 LYS A 31 ? ? -37.58 92.90 382 18 ASP A 40 ? ? 44.77 -98.68 383 18 GLU A 41 ? ? -142.48 10.78 384 18 SER B 3 ? ? -61.52 -141.51 385 18 VAL B 10 ? ? -68.26 -150.17 386 18 ASP B 11 ? ? -150.16 -149.67 387 18 VAL B 17 ? ? 37.44 30.89 388 18 PRO B 19 ? ? -64.54 94.21 389 18 GLU B 21 ? ? -39.83 -28.95 390 18 ALA B 29 ? ? -116.63 -147.64 391 18 LYS B 31 ? ? -35.60 92.19 392 18 ASP B 40 ? ? 51.76 -88.52 393 18 GLU B 41 ? ? -157.50 27.32 394 18 LYS B 47 ? ? -39.88 141.76 395 18 TYR B 48 ? ? -55.04 101.53 396 18 ASN B 51 ? ? -63.65 81.68 397 19 SER A 3 ? ? -55.90 -166.02 398 19 VAL A 10 ? ? -67.58 -154.92 399 19 ASP A 11 ? ? -150.11 -145.27 400 19 VAL A 17 ? ? 37.61 30.41 401 19 ALA A 29 ? ? -114.92 -145.04 402 19 LYS A 31 ? ? -36.71 92.46 403 19 ASP A 40 ? ? 55.77 -88.83 404 19 GLU A 41 ? ? -162.51 24.12 405 19 MET A 52 ? ? -88.53 -81.38 406 19 SER B 3 ? ? -41.68 165.74 407 19 VAL B 10 ? ? -62.25 -152.32 408 19 ASP B 11 ? ? -150.12 -144.45 409 19 VAL B 16 ? ? -113.26 65.34 410 19 VAL B 17 ? ? 37.52 30.89 411 19 PRO B 19 ? ? -64.64 99.16 412 19 ALA B 29 ? ? -121.99 -154.65 413 19 LYS B 31 ? ? -37.64 92.50 414 19 ASP B 40 ? ? 53.71 -87.12 415 19 GLU B 41 ? ? -159.49 21.24 416 19 ASN B 51 ? ? -100.01 65.35 417 20 SER A 3 ? ? -71.63 -157.68 418 20 VAL A 10 ? ? -61.99 -152.19 419 20 ASP A 11 ? ? -150.12 -148.48 420 20 VAL A 17 ? ? 37.40 30.75 421 20 PRO A 19 ? ? -64.66 99.81 422 20 ALA A 29 ? ? -112.24 -148.81 423 20 LYS A 31 ? ? -35.46 92.58 424 20 ASP A 40 ? ? 53.41 -88.13 425 20 GLU A 41 ? ? -158.28 18.77 426 20 TYR A 48 ? ? -165.87 -167.94 427 20 MET A 52 ? ? -42.27 94.70 428 20 SER B 3 ? ? -41.65 165.25 429 20 VAL B 10 ? ? -62.58 -152.36 430 20 ASP B 11 ? ? -150.11 -150.49 431 20 VAL B 17 ? ? 37.25 31.00 432 20 GLU B 30 ? ? -58.90 -167.95 433 20 LYS B 31 ? ? -37.19 93.35 434 20 ASP B 40 ? ? 51.97 -93.69 435 20 GLU B 41 ? ? -150.37 16.69 436 20 ASN B 51 ? ? -85.66 43.70 437 20 MET B 52 ? ? -165.15 -167.39 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 8 ? ? 0.317 'SIDE CHAIN' 2 1 ARG A 15 ? ? 0.317 'SIDE CHAIN' 3 1 ARG A 23 ? ? 0.246 'SIDE CHAIN' 4 1 ARG A 24 ? ? 0.315 'SIDE CHAIN' 5 1 ARG B 8 ? ? 0.107 'SIDE CHAIN' 6 1 ARG B 15 ? ? 0.263 'SIDE CHAIN' 7 1 ARG B 23 ? ? 0.210 'SIDE CHAIN' 8 1 ARG B 24 ? ? 0.103 'SIDE CHAIN' 9 2 ARG A 8 ? ? 0.183 'SIDE CHAIN' 10 2 ARG A 15 ? ? 0.316 'SIDE CHAIN' 11 2 ARG A 23 ? ? 0.293 'SIDE CHAIN' 12 2 ARG A 24 ? ? 0.312 'SIDE CHAIN' 13 2 ARG B 8 ? ? 0.187 'SIDE CHAIN' 14 2 ARG B 15 ? ? 0.316 'SIDE CHAIN' 15 2 ARG B 23 ? ? 0.278 'SIDE CHAIN' 16 2 ARG B 24 ? ? 0.317 'SIDE CHAIN' 17 3 ARG A 15 ? ? 0.291 'SIDE CHAIN' 18 3 ARG A 23 ? ? 0.187 'SIDE CHAIN' 19 3 ARG A 24 ? ? 0.214 'SIDE CHAIN' 20 3 ARG B 8 ? ? 0.121 'SIDE CHAIN' 21 3 ARG B 15 ? ? 0.313 'SIDE CHAIN' 22 3 ARG B 23 ? ? 0.303 'SIDE CHAIN' 23 3 ARG B 24 ? ? 0.260 'SIDE CHAIN' 24 4 ARG A 8 ? ? 0.104 'SIDE CHAIN' 25 4 ARG A 15 ? ? 0.289 'SIDE CHAIN' 26 4 ARG A 23 ? ? 0.192 'SIDE CHAIN' 27 4 ARG A 24 ? ? 0.235 'SIDE CHAIN' 28 4 ARG B 8 ? ? 0.166 'SIDE CHAIN' 29 4 ARG B 15 ? ? 0.178 'SIDE CHAIN' 30 4 ARG B 23 ? ? 0.206 'SIDE CHAIN' 31 4 ARG B 24 ? ? 0.202 'SIDE CHAIN' 32 5 ARG A 8 ? ? 0.170 'SIDE CHAIN' 33 5 ARG A 15 ? ? 0.308 'SIDE CHAIN' 34 5 ARG A 23 ? ? 0.183 'SIDE CHAIN' 35 5 ARG B 8 ? ? 0.140 'SIDE CHAIN' 36 5 ARG B 15 ? ? 0.277 'SIDE CHAIN' 37 5 ARG B 23 ? ? 0.274 'SIDE CHAIN' 38 5 ARG B 24 ? ? 0.231 'SIDE CHAIN' 39 6 ARG A 8 ? ? 0.267 'SIDE CHAIN' 40 6 ARG A 15 ? ? 0.313 'SIDE CHAIN' 41 6 ARG A 23 ? ? 0.280 'SIDE CHAIN' 42 6 ARG B 8 ? ? 0.217 'SIDE CHAIN' 43 6 ARG B 15 ? ? 0.311 'SIDE CHAIN' 44 6 ARG B 23 ? ? 0.194 'SIDE CHAIN' 45 6 ARG B 24 ? ? 0.268 'SIDE CHAIN' 46 7 ARG A 8 ? ? 0.191 'SIDE CHAIN' 47 7 ARG A 15 ? ? 0.317 'SIDE CHAIN' 48 7 ARG A 23 ? ? 0.200 'SIDE CHAIN' 49 7 ARG A 24 ? ? 0.286 'SIDE CHAIN' 50 7 ARG B 8 ? ? 0.173 'SIDE CHAIN' 51 7 ARG B 15 ? ? 0.318 'SIDE CHAIN' 52 7 ARG B 23 ? ? 0.148 'SIDE CHAIN' 53 7 ARG B 24 ? ? 0.144 'SIDE CHAIN' 54 8 ARG A 8 ? ? 0.093 'SIDE CHAIN' 55 8 ARG A 15 ? ? 0.284 'SIDE CHAIN' 56 8 ARG A 23 ? ? 0.260 'SIDE CHAIN' 57 8 ARG A 24 ? ? 0.274 'SIDE CHAIN' 58 8 ARG B 8 ? ? 0.265 'SIDE CHAIN' 59 8 ARG B 15 ? ? 0.308 'SIDE CHAIN' 60 8 ARG B 23 ? ? 0.235 'SIDE CHAIN' 61 8 ARG B 24 ? ? 0.313 'SIDE CHAIN' 62 9 ARG A 8 ? ? 0.261 'SIDE CHAIN' 63 9 ARG A 15 ? ? 0.295 'SIDE CHAIN' 64 9 ARG A 23 ? ? 0.286 'SIDE CHAIN' 65 9 ARG A 24 ? ? 0.266 'SIDE CHAIN' 66 9 ARG B 8 ? ? 0.111 'SIDE CHAIN' 67 9 ARG B 15 ? ? 0.315 'SIDE CHAIN' 68 9 ARG B 23 ? ? 0.293 'SIDE CHAIN' 69 9 ARG B 24 ? ? 0.316 'SIDE CHAIN' 70 10 ARG A 8 ? ? 0.090 'SIDE CHAIN' 71 10 ARG A 15 ? ? 0.316 'SIDE CHAIN' 72 10 ARG A 23 ? ? 0.275 'SIDE CHAIN' 73 10 ARG A 24 ? ? 0.188 'SIDE CHAIN' 74 10 ARG B 8 ? ? 0.174 'SIDE CHAIN' 75 10 ARG B 15 ? ? 0.282 'SIDE CHAIN' 76 10 ARG B 23 ? ? 0.281 'SIDE CHAIN' 77 10 ARG B 24 ? ? 0.156 'SIDE CHAIN' 78 11 ARG A 8 ? ? 0.273 'SIDE CHAIN' 79 11 ARG A 15 ? ? 0.292 'SIDE CHAIN' 80 11 ARG A 23 ? ? 0.217 'SIDE CHAIN' 81 11 ARG A 24 ? ? 0.198 'SIDE CHAIN' 82 11 ARG B 8 ? ? 0.300 'SIDE CHAIN' 83 11 ARG B 15 ? ? 0.295 'SIDE CHAIN' 84 11 ARG B 23 ? ? 0.187 'SIDE CHAIN' 85 12 ARG A 8 ? ? 0.214 'SIDE CHAIN' 86 12 ARG A 15 ? ? 0.306 'SIDE CHAIN' 87 12 ARG A 23 ? ? 0.204 'SIDE CHAIN' 88 12 ARG A 24 ? ? 0.091 'SIDE CHAIN' 89 12 ARG B 8 ? ? 0.282 'SIDE CHAIN' 90 12 ARG B 15 ? ? 0.288 'SIDE CHAIN' 91 12 ARG B 23 ? ? 0.183 'SIDE CHAIN' 92 12 ARG B 24 ? ? 0.188 'SIDE CHAIN' 93 13 ARG A 8 ? ? 0.134 'SIDE CHAIN' 94 13 ARG A 15 ? ? 0.290 'SIDE CHAIN' 95 13 ARG A 23 ? ? 0.231 'SIDE CHAIN' 96 13 ARG A 24 ? ? 0.113 'SIDE CHAIN' 97 13 ARG B 8 ? ? 0.281 'SIDE CHAIN' 98 13 ARG B 15 ? ? 0.172 'SIDE CHAIN' 99 13 ARG B 23 ? ? 0.175 'SIDE CHAIN' 100 13 ARG B 24 ? ? 0.205 'SIDE CHAIN' 101 14 ARG A 8 ? ? 0.240 'SIDE CHAIN' 102 14 ARG A 15 ? ? 0.296 'SIDE CHAIN' 103 14 ARG A 23 ? ? 0.168 'SIDE CHAIN' 104 14 ARG A 24 ? ? 0.239 'SIDE CHAIN' 105 14 ARG B 8 ? ? 0.096 'SIDE CHAIN' 106 14 ARG B 15 ? ? 0.295 'SIDE CHAIN' 107 14 ARG B 23 ? ? 0.193 'SIDE CHAIN' 108 14 ARG B 24 ? ? 0.277 'SIDE CHAIN' 109 15 ARG A 8 ? ? 0.215 'SIDE CHAIN' 110 15 ARG A 15 ? ? 0.313 'SIDE CHAIN' 111 15 ARG A 23 ? ? 0.223 'SIDE CHAIN' 112 15 ARG A 24 ? ? 0.309 'SIDE CHAIN' 113 15 ARG B 8 ? ? 0.091 'SIDE CHAIN' 114 15 ARG B 15 ? ? 0.312 'SIDE CHAIN' 115 15 ARG B 23 ? ? 0.187 'SIDE CHAIN' 116 15 ARG B 24 ? ? 0.141 'SIDE CHAIN' 117 16 ARG A 8 ? ? 0.154 'SIDE CHAIN' 118 16 ARG A 15 ? ? 0.315 'SIDE CHAIN' 119 16 ARG A 23 ? ? 0.203 'SIDE CHAIN' 120 16 ARG A 24 ? ? 0.277 'SIDE CHAIN' 121 16 ARG B 15 ? ? 0.304 'SIDE CHAIN' 122 16 ARG B 23 ? ? 0.216 'SIDE CHAIN' 123 16 ARG B 24 ? ? 0.312 'SIDE CHAIN' 124 17 ARG A 8 ? ? 0.197 'SIDE CHAIN' 125 17 ARG A 15 ? ? 0.290 'SIDE CHAIN' 126 17 ARG A 23 ? ? 0.201 'SIDE CHAIN' 127 17 ARG B 8 ? ? 0.224 'SIDE CHAIN' 128 17 ARG B 15 ? ? 0.306 'SIDE CHAIN' 129 17 ARG B 23 ? ? 0.265 'SIDE CHAIN' 130 17 ARG B 24 ? ? 0.278 'SIDE CHAIN' 131 18 ARG A 8 ? ? 0.262 'SIDE CHAIN' 132 18 ARG A 15 ? ? 0.313 'SIDE CHAIN' 133 18 ARG A 23 ? ? 0.276 'SIDE CHAIN' 134 18 ARG A 24 ? ? 0.131 'SIDE CHAIN' 135 18 ARG B 15 ? ? 0.234 'SIDE CHAIN' 136 18 ARG B 23 ? ? 0.125 'SIDE CHAIN' 137 18 ARG B 24 ? ? 0.191 'SIDE CHAIN' 138 19 ARG A 8 ? ? 0.279 'SIDE CHAIN' 139 19 ARG A 15 ? ? 0.279 'SIDE CHAIN' 140 19 ARG A 23 ? ? 0.229 'SIDE CHAIN' 141 19 ARG A 24 ? ? 0.123 'SIDE CHAIN' 142 19 ARG B 8 ? ? 0.306 'SIDE CHAIN' 143 19 ARG B 15 ? ? 0.178 'SIDE CHAIN' 144 19 ARG B 23 ? ? 0.211 'SIDE CHAIN' 145 19 ARG B 24 ? ? 0.291 'SIDE CHAIN' 146 20 ARG A 8 ? ? 0.177 'SIDE CHAIN' 147 20 ARG A 15 ? ? 0.306 'SIDE CHAIN' 148 20 ARG A 23 ? ? 0.221 'SIDE CHAIN' 149 20 ARG A 24 ? ? 0.188 'SIDE CHAIN' 150 20 ARG B 8 ? ? 0.152 'SIDE CHAIN' 151 20 ARG B 15 ? ? 0.258 'SIDE CHAIN' 152 20 ARG B 23 ? ? 0.226 'SIDE CHAIN' 153 20 ARG B 24 ? ? 0.079 'SIDE CHAIN' #