data_1EPJ # _entry.id 1EPJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1EPJ WWPDB D_1000173115 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1EPI _pdbx_database_related.details . _pdbx_database_related.content_type 'representative structure' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1EPJ _pdbx_database_status.recvd_initial_deposition_date 1992-03-24 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kohda, D.' 1 'Inagaki, F.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Three-dimensional nuclear magnetic resonance structures of mouse epidermal growth factor in acidic and physiological pH solutions.' Biochemistry 31 11928 11939 1992 BICHAW US 0006-2960 0033 ? 1445923 10.1021/bi00162a036 1 ;Structure of Epidermal Growth Factor Bound to Perdeuterated Dodecylphosphocholine Micelles Determined by Two-Dimensional NMR and Simulated Annealing Calculations ; Biochemistry 31 677 ? 1992 BICHAW US 0006-2960 0033 ? ? ? 2 ;Characterization of Ph Titration Shifts for All the Nonlabile Proton Resonances in a Protein by Two-Dimensional NMR: The Case of Mouse Epidermal Growth Factor ; Biochemistry 30 4896 ? 1991 BICHAW US 0006-2960 0033 ? ? ? 3 'Tertiary Structure of Mouse Epidermal Growth Factor Determined by Two-Dimensional 1H NMR' 'J.Biochem.(Tokyo)' 103 741 ? 1988 JOBIAO JA 0021-924X 0418 ? ? ? 4 'A Comparative 1H NMR Study of Mouse Alpha(1-53) and Beta(2-53) Epidermal Growth Factors' Biochem.Int. 16 647 ? 1988 BIINDF AT 0158-5231 0758 ? ? ? 5 'Complete Sequence-Specific 1H Nuclear Magnetic Resonance Assignments for Mouse Epidermal Growth Factor' 'J.Biochem.(Tokyo)' 103 554 ? 1988 JOBIAO JA 0021-924X 0418 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kohda, D.' 1 primary 'Inagaki, F.' 2 1 'Kohda, D.' 3 1 'Inagaki, F.' 4 2 'Kohda, D.' 5 2 'Sawada, T.' 6 2 'Inagaki, F.' 7 3 'Kohda, D.' 8 3 'Go, N.' 9 3 'Hayashi, K.' 10 3 'Inagaki, F.' 11 4 'Kohda, D.' 12 4 'Kodama, C.' 13 4 'Kase, R.' 14 4 'Nomoto, H.' 15 4 'Hayashi, K.' 16 4 'Inagaki, F.' 17 5 'Kohda, D.' 18 5 'Inagaki, F.' 19 # _cell.entry_id 1EPJ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1EPJ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'EPIDERMAL GROWTH FACTOR' _entity.formula_weight 6050.717 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR _entity_poly.pdbx_seq_one_letter_code_can NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 SER n 1 3 TYR n 1 4 PRO n 1 5 GLY n 1 6 CYS n 1 7 PRO n 1 8 SER n 1 9 SER n 1 10 TYR n 1 11 ASP n 1 12 GLY n 1 13 TYR n 1 14 CYS n 1 15 LEU n 1 16 ASN n 1 17 GLY n 1 18 GLY n 1 19 VAL n 1 20 CYS n 1 21 MET n 1 22 HIS n 1 23 ILE n 1 24 GLU n 1 25 SER n 1 26 LEU n 1 27 ASP n 1 28 SER n 1 29 TYR n 1 30 THR n 1 31 CYS n 1 32 ASN n 1 33 CYS n 1 34 VAL n 1 35 ILE n 1 36 GLY n 1 37 TYR n 1 38 SER n 1 39 GLY n 1 40 ASP n 1 41 ARG n 1 42 CYS n 1 43 GLN n 1 44 THR n 1 45 ARG n 1 46 ASP n 1 47 LEU n 1 48 ARG n 1 49 TRP n 1 50 TRP n 1 51 GLU n 1 52 LEU n 1 53 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EGF_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01132 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MPWGRRPTWLLLAFLLVFLKISILSVTAWQTGNCQPGPLERSERSGTCAGPAPFLVFSQGKSISRIDPDGTNHQQLVVDA GISADMDIHYKKERLYWVDVERQVLLRVFLNGTGLEKVCNVERKVSGLAIDWIDDEVLWVDQQNGVITVTDMTGKNSRVL LSSLKHPSNIAVDPIERLMFWSSEVTGSLHRAHLKGVDVKTLLETGGISVLTLDVLDKRLFWVQDSGEGSHAYIHSCDYE GGSVRLIRHQARHSLSSMAFFGDRIFYSVLKSKAIWIANKHTGKDTVRINLHPSFVTPGKLMVVHPRAQPRTEDAAKDPD PELLKQRGRPCRFGLCERDPKSHSSACAEGYTLSRDRKYCEDVNECATQNHGCTLGCENTPGSYHCTCPTGFVLLPDGKQ CHELVSCPGNVSKCSHGCVLTSDGPRCICPAGSVLGRDGKTCTGCSSPDNGGCSQICLPLRPGSWECDCFPGYDLQSDRK SCAASGPQPLLLFANSQDIRHMHFDGTDYKVLLSRQMGMVFALDYDPVESKIYFAQTALKWIERANMDGSQRERLITEGV DTLEGLALDWIGRRIYWTDSGKSVVGGSDLSGKHHRIIIQERISRPRGIAVHPRARRLFWTDVGMSPRIESASLQGSDRV LIASSNLLEPSGITIDYLTDTLYWCDTKRSVIEMANLDGSKRRRLIQNDVGHPFSLAVFEDHLWVSDWAIPSVIRVNKRT GQNRVRLQGSMLKPSSLVVVHPLAKPGADPCLYRNGGCEHICQESLGTARCLCREGFVKAWDGKMCLPQDYPILSGENAD LSKEVTSLSNSTQAEVPDDDGTESSTLVAEIMVSGMNYEDDCGPGGCGSHARCVSDGETAECQCLKGFARDGNLCSDIDE CVLARSDCPSTSSRCINTEGGYVCRCSEGYEGDGISCFDIDECQRGAHNCAENAACTNTEGGYNCTCAGRPSSPGRSCPD STAPSLLGEDGHHLDRNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELRHAGYGQKHDIM VVAVCMVALVLLLLLGMWGTYYYRTRKQLSNPPKNPCDEPSGSVSSSGPDSSSGAAVASCPQPWFVVLEKHQDPKNGSLP ADGTNGAVVDAGLSPSLQLGSVHLTSWRQKPHIDGMGTGQSCWIPPSSDRGPQEIEGNSHLPSYRPVGPEKLHSLQSANG SCHERAPDLPRQTEPVK ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1EPJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 53 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01132 _struct_ref_seq.db_align_beg 977 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1029 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 53 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1EPJ _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 5 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1EPJ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1EPJ _struct.title 'THREE-DIMENSIONAL NUCLEAR MAGNETIC RESONANCE STRUCTURES OF MOUSE EPIDERMAL GROWTH FACTOR IN ACIDIC AND PHYSIOLOGICAL PH SOLUTIONS' _struct.pdbx_descriptor 'EPIDERMAL GROWTH FACTOR (EGF) IN PH 6.8 SOLUTION (NMR, 5 STRUCTURES)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1EPJ _struct_keywords.pdbx_keywords 'GROWTH FACTOR' _struct_keywords.text 'GROWTH FACTOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 20 SG ? ? A CYS 6 A CYS 20 1_555 ? ? ? ? ? ? ? 2.014 ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 14 A CYS 31 1_555 ? ? ? ? ? ? ? 2.018 ? disulf3 disulf ? ? A CYS 33 SG ? ? ? 1_555 A CYS 42 SG ? ? A CYS 33 A CYS 42 1_555 ? ? ? ? ? ? ? 2.027 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details SAB ? 3 ? SC ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense SAB 1 2 ? anti-parallel SAB 2 3 ? anti-parallel SC 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id SAB 1 SER A 2 ? PRO A 4 ? SER A 2 PRO A 4 SAB 2 VAL A 19 ? ILE A 23 ? VAL A 19 ILE A 23 SAB 3 SER A 28 ? ASN A 32 ? SER A 28 ASN A 32 SC 1 TYR A 37 ? SER A 38 ? TYR A 37 SER A 38 SC 2 THR A 44 ? ARG A 45 ? THR A 44 ARG A 45 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id SAB 1 2 N TYR A 3 ? N TYR A 3 O HIS A 22 ? O HIS A 22 SAB 2 3 N MET A 21 ? N MET A 21 O THR A 30 ? O THR A 30 SC 1 2 N SER A 38 ? N SER A 38 O THR A 44 ? O THR A 44 # _database_PDB_matrix.entry_id 1EPJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1EPJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 1 1 ASN ASN A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 TRP 49 49 49 TRP TRP A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ARG 53 53 53 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-01-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 HG1 A THR 30 ? ? H A CYS 31 ? ? 1.29 2 4 HH11 A ARG 48 ? ? HH12 A ARG 53 ? ? 1.34 3 5 H A SER 9 ? ? H A TYR 10 ? ? 1.35 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A HIS 22 ? ? ND1 A HIS 22 ? ? 1.269 1.369 -0.100 0.015 N 2 2 CG A HIS 22 ? ? ND1 A HIS 22 ? ? 1.269 1.369 -0.100 0.015 N 3 3 CG A HIS 22 ? ? ND1 A HIS 22 ? ? 1.268 1.369 -0.101 0.015 N 4 4 CG A HIS 22 ? ? ND1 A HIS 22 ? ? 1.269 1.369 -0.100 0.015 N 5 5 CG A HIS 22 ? ? ND1 A HIS 22 ? ? 1.269 1.369 -0.100 0.015 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A TYR 37 ? ? CG A TYR 37 ? ? CD2 A TYR 37 ? ? 114.73 121.00 -6.27 0.60 N 2 1 CB A TYR 37 ? ? CG A TYR 37 ? ? CD1 A TYR 37 ? ? 124.67 121.00 3.67 0.60 N 3 1 CG A TRP 49 ? ? CD1 A TRP 49 ? ? NE1 A TRP 49 ? ? 103.03 110.10 -7.07 1.00 N 4 1 CD1 A TRP 49 ? ? NE1 A TRP 49 ? ? CE2 A TRP 49 ? ? 115.76 109.00 6.76 0.90 N 5 1 NE1 A TRP 49 ? ? CE2 A TRP 49 ? ? CZ2 A TRP 49 ? ? 139.12 130.40 8.72 1.10 N 6 1 NE1 A TRP 49 ? ? CE2 A TRP 49 ? ? CD2 A TRP 49 ? ? 100.88 107.30 -6.42 1.00 N 7 1 CG A TRP 50 ? ? CD1 A TRP 50 ? ? NE1 A TRP 50 ? ? 104.03 110.10 -6.07 1.00 N 8 1 CD1 A TRP 50 ? ? NE1 A TRP 50 ? ? CE2 A TRP 50 ? ? 115.86 109.00 6.86 0.90 N 9 2 CB A TYR 37 ? ? CG A TYR 37 ? ? CD2 A TYR 37 ? ? 115.14 121.00 -5.86 0.60 N 10 2 CG A TRP 49 ? ? CD1 A TRP 49 ? ? NE1 A TRP 49 ? ? 103.61 110.10 -6.49 1.00 N 11 2 CD1 A TRP 49 ? ? NE1 A TRP 49 ? ? CE2 A TRP 49 ? ? 115.40 109.00 6.40 0.90 N 12 2 NE1 A TRP 49 ? ? CE2 A TRP 49 ? ? CZ2 A TRP 49 ? ? 138.00 130.40 7.60 1.10 N 13 2 CG A TRP 50 ? ? CD1 A TRP 50 ? ? NE1 A TRP 50 ? ? 103.28 110.10 -6.82 1.00 N 14 2 CD1 A TRP 50 ? ? NE1 A TRP 50 ? ? CE2 A TRP 50 ? ? 116.00 109.00 7.00 0.90 N 15 3 CB A TYR 37 ? ? CG A TYR 37 ? ? CD2 A TYR 37 ? ? 113.76 121.00 -7.24 0.60 N 16 3 CB A TYR 37 ? ? CG A TYR 37 ? ? CD1 A TYR 37 ? ? 125.00 121.00 4.00 0.60 N 17 3 CG A TRP 49 ? ? CD1 A TRP 49 ? ? NE1 A TRP 49 ? ? 103.39 110.10 -6.71 1.00 N 18 3 CD1 A TRP 49 ? ? NE1 A TRP 49 ? ? CE2 A TRP 49 ? ? 115.96 109.00 6.96 0.90 N 19 3 NE1 A TRP 49 ? ? CE2 A TRP 49 ? ? CZ2 A TRP 49 ? ? 138.24 130.40 7.84 1.10 N 20 3 NE1 A TRP 49 ? ? CE2 A TRP 49 ? ? CD2 A TRP 49 ? ? 101.29 107.30 -6.01 1.00 N 21 3 CD1 A TRP 50 ? ? NE1 A TRP 50 ? ? CE2 A TRP 50 ? ? 115.25 109.00 6.25 0.90 N 22 4 CB A TYR 37 ? ? CG A TYR 37 ? ? CD2 A TYR 37 ? ? 113.83 121.00 -7.17 0.60 N 23 4 CB A TYR 37 ? ? CG A TYR 37 ? ? CD1 A TYR 37 ? ? 125.02 121.00 4.02 0.60 N 24 4 CG A TRP 49 ? ? CD1 A TRP 49 ? ? NE1 A TRP 49 ? ? 103.29 110.10 -6.81 1.00 N 25 4 CD1 A TRP 49 ? ? NE1 A TRP 49 ? ? CE2 A TRP 49 ? ? 115.49 109.00 6.49 0.90 N 26 4 NE1 A TRP 49 ? ? CE2 A TRP 49 ? ? CZ2 A TRP 49 ? ? 138.28 130.40 7.88 1.10 N 27 4 CG A TRP 50 ? ? CD1 A TRP 50 ? ? NE1 A TRP 50 ? ? 103.76 110.10 -6.34 1.00 N 28 4 CD1 A TRP 50 ? ? NE1 A TRP 50 ? ? CE2 A TRP 50 ? ? 116.01 109.00 7.01 0.90 N 29 5 CB A TYR 37 ? ? CG A TYR 37 ? ? CD2 A TYR 37 ? ? 115.28 121.00 -5.72 0.60 N 30 5 CG A TRP 49 ? ? CD1 A TRP 49 ? ? NE1 A TRP 49 ? ? 103.64 110.10 -6.46 1.00 N 31 5 CD1 A TRP 49 ? ? NE1 A TRP 49 ? ? CE2 A TRP 49 ? ? 115.99 109.00 6.99 0.90 N 32 5 NE1 A TRP 49 ? ? CE2 A TRP 49 ? ? CZ2 A TRP 49 ? ? 138.83 130.40 8.43 1.10 N 33 5 NE1 A TRP 49 ? ? CE2 A TRP 49 ? ? CD2 A TRP 49 ? ? 101.05 107.30 -6.25 1.00 N 34 5 CD1 A TRP 50 ? ? NE1 A TRP 50 ? ? CE2 A TRP 50 ? ? 116.10 109.00 7.10 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 7 ? ? -44.84 171.30 2 1 SER A 9 ? ? -62.00 -133.02 3 1 TYR A 10 ? ? 35.60 33.62 4 1 ASN A 16 ? ? -55.58 -158.41 5 1 ILE A 23 ? ? 58.11 134.72 6 1 GLU A 24 ? ? -54.49 83.94 7 1 ASP A 27 ? ? -151.04 -116.86 8 1 SER A 28 ? ? 53.01 115.64 9 1 CYS A 33 ? ? -59.87 -153.94 10 1 ARG A 41 ? ? -170.56 50.28 11 1 ASP A 46 ? ? -79.72 42.45 12 1 LEU A 47 ? ? 46.16 177.73 13 1 ARG A 48 ? ? -42.74 102.43 14 1 TRP A 49 ? ? -162.98 84.05 15 1 TRP A 50 ? ? 149.92 -94.71 16 2 CYS A 6 ? ? -173.49 134.64 17 2 PRO A 7 ? ? -50.03 -171.45 18 2 SER A 8 ? ? -50.07 -102.62 19 2 SER A 9 ? ? -4.59 -56.73 20 2 TYR A 10 ? ? -52.12 2.01 21 2 LEU A 15 ? ? -81.32 -147.74 22 2 ASN A 16 ? ? 37.80 -156.54 23 2 ILE A 23 ? ? 54.90 154.50 24 2 LEU A 26 ? ? 46.20 96.76 25 2 SER A 28 ? ? 167.73 -22.62 26 2 TYR A 29 ? ? 55.48 120.46 27 2 CYS A 33 ? ? -67.49 -151.52 28 2 SER A 38 ? ? -155.36 -144.20 29 2 ARG A 41 ? ? -168.54 66.34 30 2 CYS A 42 ? ? 55.72 13.61 31 2 ASP A 46 ? ? -77.37 46.44 32 2 LEU A 47 ? ? 44.33 -100.91 33 2 TRP A 50 ? ? -68.67 -107.17 34 2 GLU A 51 ? ? 105.73 -7.80 35 3 SER A 2 ? ? -48.55 -16.48 36 3 TYR A 3 ? ? -43.79 158.84 37 3 CYS A 6 ? ? -178.75 119.17 38 3 PRO A 7 ? ? -52.26 -177.03 39 3 SER A 8 ? ? -90.31 -72.69 40 3 SER A 9 ? ? -37.16 -32.46 41 3 TYR A 10 ? ? -93.61 36.19 42 3 TYR A 13 ? ? -28.27 -62.93 43 3 ILE A 23 ? ? 51.05 -86.55 44 3 GLU A 24 ? ? -148.81 -125.16 45 3 ASP A 27 ? ? -80.39 -94.23 46 3 SER A 28 ? ? 36.38 23.74 47 3 CYS A 33 ? ? -72.33 -162.52 48 3 ASP A 40 ? ? 62.12 -74.29 49 3 ARG A 41 ? ? -147.19 54.63 50 3 CYS A 42 ? ? 59.49 16.91 51 3 ASP A 46 ? ? -75.82 40.48 52 3 LEU A 47 ? ? 50.45 109.08 53 3 ARG A 48 ? ? 25.16 13.90 54 4 CYS A 6 ? ? 175.66 118.85 55 4 PRO A 7 ? ? -45.35 168.46 56 4 SER A 8 ? ? -50.04 -9.12 57 4 SER A 9 ? ? -91.99 -131.33 58 4 TYR A 10 ? ? 39.29 48.64 59 4 ILE A 23 ? ? -108.37 -75.39 60 4 SER A 25 ? ? -59.57 -100.71 61 4 ASP A 27 ? ? 45.50 -150.32 62 4 SER A 28 ? ? 63.86 -118.26 63 4 TYR A 29 ? ? 56.91 135.60 64 4 CYS A 33 ? ? -59.50 -158.91 65 4 SER A 38 ? ? -168.76 -124.41 66 4 ASP A 40 ? ? -167.44 -32.81 67 4 ARG A 41 ? ? -163.58 27.95 68 4 ASP A 46 ? ? -77.55 47.33 69 4 LEU A 47 ? ? 15.32 104.84 70 4 ARG A 48 ? ? 53.81 126.91 71 4 TRP A 49 ? ? -174.20 -23.45 72 4 TRP A 50 ? ? -110.94 -94.61 73 4 GLU A 51 ? ? -109.88 -92.89 74 5 CYS A 6 ? ? -171.54 111.08 75 5 PRO A 7 ? ? -51.90 174.20 76 5 SER A 9 ? ? -163.82 -10.02 77 5 ASN A 16 ? ? -66.47 -168.66 78 5 ILE A 23 ? ? 29.18 106.44 79 5 LEU A 26 ? ? 43.13 95.89 80 5 SER A 28 ? ? -145.03 -12.56 81 5 TYR A 29 ? ? 55.54 120.79 82 5 CYS A 33 ? ? -56.23 -160.26 83 5 SER A 38 ? ? -162.21 -161.83 84 5 ARG A 41 ? ? 172.22 69.71 85 5 CYS A 42 ? ? 44.85 18.37 86 5 LEU A 47 ? ? 6.43 118.58 87 5 ARG A 48 ? ? 9.72 113.11 88 5 TRP A 49 ? ? -159.89 -34.82 89 5 TRP A 50 ? ? -100.17 -97.17 90 5 GLU A 51 ? ? -60.33 -164.56 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 37 ? ? 0.105 'SIDE CHAIN' 2 1 ARG A 41 ? ? 0.307 'SIDE CHAIN' 3 1 ARG A 45 ? ? 0.287 'SIDE CHAIN' 4 1 ARG A 53 ? ? 0.274 'SIDE CHAIN' 5 2 TYR A 37 ? ? 0.104 'SIDE CHAIN' 6 2 ARG A 41 ? ? 0.102 'SIDE CHAIN' 7 2 ARG A 45 ? ? 0.151 'SIDE CHAIN' 8 2 ARG A 48 ? ? 0.314 'SIDE CHAIN' 9 2 ARG A 53 ? ? 0.307 'SIDE CHAIN' 10 3 TYR A 37 ? ? 0.104 'SIDE CHAIN' 11 3 ARG A 41 ? ? 0.092 'SIDE CHAIN' 12 3 ARG A 45 ? ? 0.315 'SIDE CHAIN' 13 3 ARG A 48 ? ? 0.079 'SIDE CHAIN' 14 3 ARG A 53 ? ? 0.306 'SIDE CHAIN' 15 4 TYR A 37 ? ? 0.104 'SIDE CHAIN' 16 4 ARG A 41 ? ? 0.314 'SIDE CHAIN' 17 4 ARG A 45 ? ? 0.276 'SIDE CHAIN' 18 4 ARG A 48 ? ? 0.216 'SIDE CHAIN' 19 4 ARG A 53 ? ? 0.319 'SIDE CHAIN' 20 5 TYR A 37 ? ? 0.105 'SIDE CHAIN' 21 5 ARG A 41 ? ? 0.307 'SIDE CHAIN' 22 5 ARG A 45 ? ? 0.313 'SIDE CHAIN' 23 5 ARG A 48 ? ? 0.314 'SIDE CHAIN' 24 5 ARG A 53 ? ? 0.285 'SIDE CHAIN' #