data_1ERB # _entry.id 1ERB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1ERB WWPDB D_1000173129 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ERB _pdbx_database_status.recvd_initial_deposition_date 1993-10-01 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zanotti, G.' 1 'Berni, R.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;The interaction of N-ethyl retinamide with plasma retinol-binding protein (RBP) and the crystal structure of the retinoid-RBP complex at 1.9-A resolution. ; J.Biol.Chem. 268 24873 24879 1993 JBCHA3 US 0021-9258 0071 ? 8227049 ? 1 'Crystal Structure of the Trigonal Form of Human Plasma Retinol-Binding Protein at 2.5 Angstroms Resolution' J.Mol.Biol. 230 613 ? 1993 JMOBAK UK 0022-2836 0070 ? ? ? 2 'Crystal Structure of Liganded and Unliganded Forms of Bovine Plasma Retinol-Binding Protein' J.Biol.Chem. 268 10728 ? 1993 JBCHA3 US 0021-9258 0071 ? ? ? 3 ;The Bovine Plasma Retinol-Binding Protein. Amino Acid Sequence, Interaction with Transthyretin, Crystallization and Preliminary X-Ray Data ; Eur.J.Biochem. 192 507 ? 1990 EJBCAI IX 0014-2956 0262 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Zanotti, G.' 1 primary 'Malpeli, G.' 2 primary 'Berni, R.' 3 1 'Zanotti, G.' 4 1 'Ottonello, S.' 5 1 'Berni, R.' 6 1 'Monaco, H.L.' 7 2 'Zanotti, G.' 8 2 'Berni, R.' 9 2 'Monaco, H.L.' 10 3 'Berni, R.' 11 3 'Stoppini, M.' 12 3 'Zapponi, C.M.' 13 3 'Meloni, M.L.' 14 3 'Monaco, H.L.' 15 3 'Zanotti, G.' 16 # _cell.entry_id 1ERB _cell.length_a 46.270 _cell.length_b 49.110 _cell.length_c 76.410 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ERB _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RETINOL BINDING PROTEIN' 21095.654 1 ? ? ? ? 2 non-polymer syn 'N-ETHYL RETINAMIDE' 327.504 1 ? ? ? ? 3 water nat water 18.015 160 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ERDCRVSSFRVKENFDKARFAGTWYAMAKKDPEGLFLQDNIVAEFSVDENGHMSATAKGRVRLLNNWDVCADMVGTFTDT EDPAKFKMKYWGVASFLQKGNDDHWIIDTDYETFAVQYSCRLLNLDGTCADSYSFVFARDPSGFSPEVQKIVRQRQEELC LARQYRLIPHNGYCDGKSERNIL ; _entity_poly.pdbx_seq_one_letter_code_can ;ERDCRVSSFRVKENFDKARFAGTWYAMAKKDPEGLFLQDNIVAEFSVDENGHMSATAKGRVRLLNNWDVCADMVGTFTDT EDPAKFKMKYWGVASFLQKGNDDHWIIDTDYETFAVQYSCRLLNLDGTCADSYSFVFARDPSGFSPEVQKIVRQRQEELC LARQYRLIPHNGYCDGKSERNIL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ARG n 1 3 ASP n 1 4 CYS n 1 5 ARG n 1 6 VAL n 1 7 SER n 1 8 SER n 1 9 PHE n 1 10 ARG n 1 11 VAL n 1 12 LYS n 1 13 GLU n 1 14 ASN n 1 15 PHE n 1 16 ASP n 1 17 LYS n 1 18 ALA n 1 19 ARG n 1 20 PHE n 1 21 ALA n 1 22 GLY n 1 23 THR n 1 24 TRP n 1 25 TYR n 1 26 ALA n 1 27 MET n 1 28 ALA n 1 29 LYS n 1 30 LYS n 1 31 ASP n 1 32 PRO n 1 33 GLU n 1 34 GLY n 1 35 LEU n 1 36 PHE n 1 37 LEU n 1 38 GLN n 1 39 ASP n 1 40 ASN n 1 41 ILE n 1 42 VAL n 1 43 ALA n 1 44 GLU n 1 45 PHE n 1 46 SER n 1 47 VAL n 1 48 ASP n 1 49 GLU n 1 50 ASN n 1 51 GLY n 1 52 HIS n 1 53 MET n 1 54 SER n 1 55 ALA n 1 56 THR n 1 57 ALA n 1 58 LYS n 1 59 GLY n 1 60 ARG n 1 61 VAL n 1 62 ARG n 1 63 LEU n 1 64 LEU n 1 65 ASN n 1 66 ASN n 1 67 TRP n 1 68 ASP n 1 69 VAL n 1 70 CYS n 1 71 ALA n 1 72 ASP n 1 73 MET n 1 74 VAL n 1 75 GLY n 1 76 THR n 1 77 PHE n 1 78 THR n 1 79 ASP n 1 80 THR n 1 81 GLU n 1 82 ASP n 1 83 PRO n 1 84 ALA n 1 85 LYS n 1 86 PHE n 1 87 LYS n 1 88 MET n 1 89 LYS n 1 90 TYR n 1 91 TRP n 1 92 GLY n 1 93 VAL n 1 94 ALA n 1 95 SER n 1 96 PHE n 1 97 LEU n 1 98 GLN n 1 99 LYS n 1 100 GLY n 1 101 ASN n 1 102 ASP n 1 103 ASP n 1 104 HIS n 1 105 TRP n 1 106 ILE n 1 107 ILE n 1 108 ASP n 1 109 THR n 1 110 ASP n 1 111 TYR n 1 112 GLU n 1 113 THR n 1 114 PHE n 1 115 ALA n 1 116 VAL n 1 117 GLN n 1 118 TYR n 1 119 SER n 1 120 CYS n 1 121 ARG n 1 122 LEU n 1 123 LEU n 1 124 ASN n 1 125 LEU n 1 126 ASP n 1 127 GLY n 1 128 THR n 1 129 CYS n 1 130 ALA n 1 131 ASP n 1 132 SER n 1 133 TYR n 1 134 SER n 1 135 PHE n 1 136 VAL n 1 137 PHE n 1 138 ALA n 1 139 ARG n 1 140 ASP n 1 141 PRO n 1 142 SER n 1 143 GLY n 1 144 PHE n 1 145 SER n 1 146 PRO n 1 147 GLU n 1 148 VAL n 1 149 GLN n 1 150 LYS n 1 151 ILE n 1 152 VAL n 1 153 ARG n 1 154 GLN n 1 155 ARG n 1 156 GLN n 1 157 GLU n 1 158 GLU n 1 159 LEU n 1 160 CYS n 1 161 LEU n 1 162 ALA n 1 163 ARG n 1 164 GLN n 1 165 TYR n 1 166 ARG n 1 167 LEU n 1 168 ILE n 1 169 PRO n 1 170 HIS n 1 171 ASN n 1 172 GLY n 1 173 TYR n 1 174 CYS n 1 175 ASP n 1 176 GLY n 1 177 LYS n 1 178 SER n 1 179 GLU n 1 180 ARG n 1 181 ASN n 1 182 ILE n 1 183 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name cattle _entity_src_gen.gene_src_genus Bos _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RETBP_BOVIN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P18902 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;ERDCRVSSFRVKENFDKARFAGTWYAMAKKDPEGLFLQDNIVAEFSVDENGHMSATAKGRVRLLNNWDVCADMVGTFTDT EDPAKFKMKYWGVASFLQKGNDDHWIIDTDYETFAVQYSCRLLNLDGTCADSYSFVFARDPSGFSPEVQKIVRQRQEELC LARQYRLIPHNGYCDGKSERNIL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ERB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 183 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P18902 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 183 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 ETR non-polymer . 'N-ETHYL RETINAMIDE' ? 'C22 H33 N O' 327.504 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1ERB _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.06 _exptl_crystal.density_percent_sol 40.21 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine.entry_id 1ERB _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high 1.9 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.172 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1401 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.number_atoms_solvent 160 _refine_hist.number_atoms_total 1585 _refine_hist.d_res_high 1.9 _refine_hist.d_res_low . # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? t_angle_deg 2.6 ? ? ? 'X-RAY DIFFRACTION' ? t_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? t_incorr_chiral_ct ? ? ? ? 'X-RAY DIFFRACTION' ? t_pseud_angle ? ? ? ? 'X-RAY DIFFRACTION' ? t_trig_c_planes ? ? ? ? 'X-RAY DIFFRACTION' ? t_gen_planes ? ? ? ? 'X-RAY DIFFRACTION' ? t_it ? ? ? ? 'X-RAY DIFFRACTION' ? t_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1ERB _struct.title ;THE INTERACTION OF N-ETHYL RETINAMIDE WITH PLASMA RETINOL-BINDING PROTEIN (RBP) AND THE CRYSTAL STRUCTURE OF THE RETINOID-RBP COMPLEX AT 1.9 ANGSTROMS RESOLUTION ; _struct.pdbx_descriptor 'RETINOL BINDING PROTEIN COMPLEX WITH N-ETHYL RETINAMIDE (N-ETHYL RETINAMIDE-RBP)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ERB _struct_keywords.pdbx_keywords 'RETINOL TRANSPORT' _struct_keywords.text 'RETINOL TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 6 ? SER A 8 ? VAL A 6 SER A 8 4 'ONE SHORT TURN' 3 HELX_P HELX_P2 2 PRO A 146 ? GLU A 158 ? PRO A 146 GLU A 158 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 160 SG ? ? A CYS 4 A CYS 160 1_555 ? ? ? ? ? ? ? 2.013 ? disulf2 disulf ? ? A CYS 70 SG ? ? ? 1_555 A CYS 174 SG ? ? A CYS 70 A CYS 174 1_555 ? ? ? ? ? ? ? 2.037 ? disulf3 disulf ? ? A CYS 120 SG ? ? ? 1_555 A CYS 129 SG ? ? A CYS 120 A CYS 129 1_555 ? ? ? ? ? ? ? 1.977 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S1 2 3 ? anti-parallel S1 3 4 ? anti-parallel S1 4 5 ? anti-parallel S1 5 6 ? anti-parallel S1 6 7 ? anti-parallel S1 7 8 ? anti-parallel S1 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 GLY A 22 ? LYS A 30 ? GLY A 22 LYS A 30 S1 2 ASP A 39 ? ASP A 48 ? ASP A 39 ASP A 48 S1 3 HIS A 52 ? LEU A 63 ? HIS A 52 LEU A 63 S1 4 TRP A 67 ? THR A 78 ? TRP A 67 THR A 78 S1 5 LYS A 85 ? GLY A 92 ? LYS A 85 GLY A 92 S1 6 LYS A 99 ? THR A 109 ? LYS A 99 THR A 109 S1 7 PHE A 114 ? ASN A 124 ? PHE A 114 ASN A 124 S1 8 CYS A 129 ? ARG A 139 ? CYS A 129 ARG A 139 S1 9 GLY A 22 ? LYS A 30 ? GLY A 22 LYS A 30 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 N ALA A 26 ? N ALA A 26 O ILE A 41 ? O ILE A 41 S1 2 3 N ASP A 48 ? N ASP A 48 O HIS A 52 ? O HIS A 52 S1 3 4 N LEU A 63 ? N LEU A 63 O TRP A 67 ? O TRP A 67 S1 4 5 O THR A 78 ? O THR A 78 N LYS A 87 ? N LYS A 87 S1 5 6 O TYR A 90 ? O TYR A 90 N GLY A 100 ? N GLY A 100 S1 6 7 O ASP A 108 ? O ASP A 108 N VAL A 116 ? N VAL A 116 S1 7 8 O LEU A 122 ? O LEU A 122 N ALA A 130 ? N ALA A 130 S1 8 9 O ALA A 138 ? O ALA A 138 N TYR A 25 ? N TYR A 25 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 7 _struct_site.details 'BINDING SITE FOR RESIDUE ETR A 184' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 LEU A 35 ? LEU A 35 . ? 1_555 ? 2 AC1 7 ALA A 57 ? ALA A 57 . ? 1_555 ? 3 AC1 7 VAL A 61 ? VAL A 61 . ? 1_555 ? 4 AC1 7 LEU A 63 ? LEU A 63 . ? 1_555 ? 5 AC1 7 MET A 73 ? MET A 73 . ? 1_555 ? 6 AC1 7 MET A 88 ? MET A 88 . ? 1_555 ? 7 AC1 7 GLN A 98 ? GLN A 98 . ? 1_555 ? # _database_PDB_matrix.entry_id 1ERB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ERB _atom_sites.fract_transf_matrix[1][1] 0.021612 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020362 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013087 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # _atom_sites_footnote.id 1 _atom_sites_footnote.text 'CYS 174 - ASP 175 OMEGA = 0.02 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 ? ? ? A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 TRP 67 67 67 TRP TRP A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 TRP 91 91 91 TRP TRP A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 TRP 105 105 105 TRP TRP A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 CYS 120 120 120 CYS CYS A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 CYS 129 129 129 CYS CYS A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 GLN 154 154 154 GLN GLN A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 GLN 156 156 156 GLN GLN A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 CYS 160 160 160 CYS CYS A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 ARG 163 163 163 ARG ARG A . n A 1 164 GLN 164 164 164 GLN GLN A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 HIS 170 170 170 HIS HIS A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 TYR 173 173 173 TYR TYR A . n A 1 174 CYS 174 174 174 CYS CYS A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 GLY 176 176 ? ? ? A . n A 1 177 LYS 177 177 ? ? ? A . n A 1 178 SER 178 178 ? ? ? A . n A 1 179 GLU 179 179 ? ? ? A . n A 1 180 ARG 180 180 ? ? ? A . n A 1 181 ASN 181 181 ? ? ? A . n A 1 182 ILE 182 182 ? ? ? A . n A 1 183 LEU 183 183 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ETR 1 184 176 ETR ETR A . C 3 HOH 1 185 177 HOH HOH A . C 3 HOH 2 186 178 HOH HOH A . C 3 HOH 3 187 179 HOH HOH A . C 3 HOH 4 188 180 HOH HOH A . C 3 HOH 5 189 181 HOH HOH A . C 3 HOH 6 190 182 HOH HOH A . C 3 HOH 7 191 183 HOH HOH A . C 3 HOH 8 192 184 HOH HOH A . C 3 HOH 9 193 185 HOH HOH A . C 3 HOH 10 194 186 HOH HOH A . C 3 HOH 11 195 187 HOH HOH A . C 3 HOH 12 196 188 HOH HOH A . C 3 HOH 13 197 189 HOH HOH A . C 3 HOH 14 198 190 HOH HOH A . C 3 HOH 15 199 191 HOH HOH A . C 3 HOH 16 200 192 HOH HOH A . C 3 HOH 17 201 193 HOH HOH A . C 3 HOH 18 202 194 HOH HOH A . C 3 HOH 19 203 195 HOH HOH A . C 3 HOH 20 204 196 HOH HOH A . C 3 HOH 21 205 197 HOH HOH A . C 3 HOH 22 206 198 HOH HOH A . C 3 HOH 23 207 199 HOH HOH A . C 3 HOH 24 208 200 HOH HOH A . C 3 HOH 25 209 201 HOH HOH A . C 3 HOH 26 210 202 HOH HOH A . C 3 HOH 27 211 203 HOH HOH A . C 3 HOH 28 212 204 HOH HOH A . C 3 HOH 29 213 205 HOH HOH A . C 3 HOH 30 214 206 HOH HOH A . C 3 HOH 31 215 207 HOH HOH A . C 3 HOH 32 216 208 HOH HOH A . C 3 HOH 33 217 209 HOH HOH A . C 3 HOH 34 218 210 HOH HOH A . C 3 HOH 35 219 211 HOH HOH A . C 3 HOH 36 220 212 HOH HOH A . C 3 HOH 37 221 213 HOH HOH A . C 3 HOH 38 222 214 HOH HOH A . C 3 HOH 39 223 215 HOH HOH A . C 3 HOH 40 224 216 HOH HOH A . C 3 HOH 41 225 217 HOH HOH A . C 3 HOH 42 226 218 HOH HOH A . C 3 HOH 43 227 219 HOH HOH A . C 3 HOH 44 228 220 HOH HOH A . C 3 HOH 45 229 221 HOH HOH A . C 3 HOH 46 230 222 HOH HOH A . C 3 HOH 47 231 223 HOH HOH A . C 3 HOH 48 232 224 HOH HOH A . C 3 HOH 49 233 225 HOH HOH A . C 3 HOH 50 234 226 HOH HOH A . C 3 HOH 51 235 227 HOH HOH A . C 3 HOH 52 236 228 HOH HOH A . C 3 HOH 53 237 229 HOH HOH A . C 3 HOH 54 238 230 HOH HOH A . C 3 HOH 55 239 231 HOH HOH A . C 3 HOH 56 240 232 HOH HOH A . C 3 HOH 57 241 233 HOH HOH A . C 3 HOH 58 242 234 HOH HOH A . C 3 HOH 59 243 235 HOH HOH A . C 3 HOH 60 244 236 HOH HOH A . C 3 HOH 61 245 237 HOH HOH A . C 3 HOH 62 246 238 HOH HOH A . C 3 HOH 63 247 239 HOH HOH A . C 3 HOH 64 248 240 HOH HOH A . C 3 HOH 65 249 241 HOH HOH A . C 3 HOH 66 250 242 HOH HOH A . C 3 HOH 67 251 243 HOH HOH A . C 3 HOH 68 252 244 HOH HOH A . C 3 HOH 69 253 245 HOH HOH A . C 3 HOH 70 254 246 HOH HOH A . C 3 HOH 71 255 247 HOH HOH A . C 3 HOH 72 256 248 HOH HOH A . C 3 HOH 73 257 249 HOH HOH A . C 3 HOH 74 258 250 HOH HOH A . C 3 HOH 75 259 251 HOH HOH A . C 3 HOH 76 260 252 HOH HOH A . C 3 HOH 77 261 253 HOH HOH A . C 3 HOH 78 262 254 HOH HOH A . C 3 HOH 79 263 255 HOH HOH A . C 3 HOH 80 264 256 HOH HOH A . C 3 HOH 81 265 257 HOH HOH A . C 3 HOH 82 266 258 HOH HOH A . C 3 HOH 83 267 259 HOH HOH A . C 3 HOH 84 268 260 HOH HOH A . C 3 HOH 85 269 261 HOH HOH A . C 3 HOH 86 270 262 HOH HOH A . C 3 HOH 87 271 263 HOH HOH A . C 3 HOH 88 272 264 HOH HOH A . C 3 HOH 89 273 265 HOH HOH A . C 3 HOH 90 274 266 HOH HOH A . C 3 HOH 91 275 267 HOH HOH A . C 3 HOH 92 276 268 HOH HOH A . C 3 HOH 93 277 269 HOH HOH A . C 3 HOH 94 278 270 HOH HOH A . C 3 HOH 95 279 271 HOH HOH A . C 3 HOH 96 280 272 HOH HOH A . C 3 HOH 97 281 273 HOH HOH A . C 3 HOH 98 282 274 HOH HOH A . C 3 HOH 99 283 275 HOH HOH A . C 3 HOH 100 284 276 HOH HOH A . C 3 HOH 101 285 277 HOH HOH A . C 3 HOH 102 286 278 HOH HOH A . C 3 HOH 103 287 279 HOH HOH A . C 3 HOH 104 288 280 HOH HOH A . C 3 HOH 105 289 281 HOH HOH A . C 3 HOH 106 290 282 HOH HOH A . C 3 HOH 107 291 283 HOH HOH A . C 3 HOH 108 292 284 HOH HOH A . C 3 HOH 109 293 285 HOH HOH A . C 3 HOH 110 294 286 HOH HOH A . C 3 HOH 111 295 287 HOH HOH A . C 3 HOH 112 296 288 HOH HOH A . C 3 HOH 113 297 289 HOH HOH A . C 3 HOH 114 298 290 HOH HOH A . C 3 HOH 115 299 291 HOH HOH A . C 3 HOH 116 300 292 HOH HOH A . C 3 HOH 117 301 293 HOH HOH A . C 3 HOH 118 302 294 HOH HOH A . C 3 HOH 119 303 295 HOH HOH A . C 3 HOH 120 304 296 HOH HOH A . C 3 HOH 121 305 297 HOH HOH A . C 3 HOH 122 306 298 HOH HOH A . C 3 HOH 123 307 299 HOH HOH A . C 3 HOH 124 308 300 HOH HOH A . C 3 HOH 125 309 301 HOH HOH A . C 3 HOH 126 310 302 HOH HOH A . C 3 HOH 127 311 303 HOH HOH A . C 3 HOH 128 312 304 HOH HOH A . C 3 HOH 129 313 306 HOH HOH A . C 3 HOH 130 314 307 HOH HOH A . C 3 HOH 131 315 308 HOH HOH A . C 3 HOH 132 316 309 HOH HOH A . C 3 HOH 133 317 310 HOH HOH A . C 3 HOH 134 318 311 HOH HOH A . C 3 HOH 135 319 312 HOH HOH A . C 3 HOH 136 320 313 HOH HOH A . C 3 HOH 137 321 314 HOH HOH A . C 3 HOH 138 322 315 HOH HOH A . C 3 HOH 139 323 316 HOH HOH A . C 3 HOH 140 324 317 HOH HOH A . C 3 HOH 141 325 318 HOH HOH A . C 3 HOH 142 326 319 HOH HOH A . C 3 HOH 143 327 320 HOH HOH A . C 3 HOH 144 328 321 HOH HOH A . C 3 HOH 145 329 322 HOH HOH A . C 3 HOH 146 330 323 HOH HOH A . C 3 HOH 147 331 324 HOH HOH A . C 3 HOH 148 332 325 HOH HOH A . C 3 HOH 149 333 326 HOH HOH A . C 3 HOH 150 334 327 HOH HOH A . C 3 HOH 151 335 328 HOH HOH A . C 3 HOH 152 336 329 HOH HOH A . C 3 HOH 153 337 330 HOH HOH A . C 3 HOH 154 338 331 HOH HOH A . C 3 HOH 155 339 332 HOH HOH A . C 3 HOH 156 340 333 HOH HOH A . C 3 HOH 157 341 334 HOH HOH A . C 3 HOH 158 342 335 HOH HOH A . C 3 HOH 159 343 336 HOH HOH A . C 3 HOH 160 344 337 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-01-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' struct_conf 3 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # _software.name TNT _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 210 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 319 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.14 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 33 ? ? OE2 A GLU 33 ? ? 1.330 1.252 0.078 0.011 N 2 1 CD A GLU 147 ? ? OE2 A GLU 147 ? ? 1.331 1.252 0.079 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 3 ? ? CG A ASP 3 ? ? OD1 A ASP 3 ? ? 123.94 118.30 5.64 0.90 N 2 1 CB A ASP 3 ? ? CG A ASP 3 ? ? OD2 A ASP 3 ? ? 112.57 118.30 -5.73 0.90 N 3 1 CB A ASP 31 ? ? CG A ASP 31 ? ? OD1 A ASP 31 ? ? 111.66 118.30 -6.64 0.90 N 4 1 CB A TRP 67 ? ? CA A TRP 67 ? ? C A TRP 67 ? ? 93.34 110.40 -17.06 2.00 N 5 1 CB A ASP 68 ? ? CG A ASP 68 ? ? OD2 A ASP 68 ? ? 112.49 118.30 -5.81 0.90 N 6 1 CB A ASP 72 ? ? CG A ASP 72 ? ? OD2 A ASP 72 ? ? 112.24 118.30 -6.06 0.90 N 7 1 CB A ASP 79 ? ? CG A ASP 79 ? ? OD1 A ASP 79 ? ? 112.78 118.30 -5.52 0.90 N 8 1 CD A ARG 121 ? ? NE A ARG 121 ? ? CZ A ARG 121 ? ? 132.69 123.60 9.09 1.40 N 9 1 NE A ARG 121 ? ? CZ A ARG 121 ? ? NH1 A ARG 121 ? ? 123.98 120.30 3.68 0.50 N 10 1 CB A ASP 131 ? ? CG A ASP 131 ? ? OD1 A ASP 131 ? ? 112.80 118.30 -5.50 0.90 N 11 1 CD A ARG 139 ? ? NE A ARG 139 ? ? CZ A ARG 139 ? ? 133.47 123.60 9.87 1.40 N 12 1 NE A ARG 139 ? ? CZ A ARG 139 ? ? NH1 A ARG 139 ? ? 124.31 120.30 4.01 0.50 N 13 1 CB A PHE 144 ? ? CA A PHE 144 ? ? C A PHE 144 ? ? 98.10 110.40 -12.30 2.00 N 14 1 NE A ARG 153 ? ? CZ A ARG 153 ? ? NH1 A ARG 153 ? ? 123.60 120.30 3.30 0.50 N 15 1 NE A ARG 155 ? ? CZ A ARG 155 ? ? NH2 A ARG 155 ? ? 123.36 120.30 3.06 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 38 ? ? -89.09 -70.37 2 1 TYR A 111 ? ? 67.30 -29.48 3 1 THR A 113 ? ? -132.06 -43.38 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 2 ? N ? A ARG 2 N 2 1 Y 1 A ASP 175 ? CA ? A ASP 175 CA 3 1 Y 1 A ASP 175 ? C ? A ASP 175 C 4 1 Y 1 A ASP 175 ? O ? A ASP 175 O 5 1 Y 1 A ASP 175 ? CB ? A ASP 175 CB 6 1 Y 1 A ASP 175 ? CG ? A ASP 175 CG 7 1 Y 1 A ASP 175 ? OD1 ? A ASP 175 OD1 8 1 Y 1 A ASP 175 ? OD2 ? A ASP 175 OD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 1 ? A GLU 1 2 1 Y 1 A GLY 176 ? A GLY 176 3 1 Y 1 A LYS 177 ? A LYS 177 4 1 Y 1 A SER 178 ? A SER 178 5 1 Y 1 A GLU 179 ? A GLU 179 6 1 Y 1 A ARG 180 ? A ARG 180 7 1 Y 1 A ASN 181 ? A ASN 181 8 1 Y 1 A ILE 182 ? A ILE 182 9 1 Y 1 A LEU 183 ? A LEU 183 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-ETHYL RETINAMIDE' ETR 3 water HOH #