data_1ERC # _entry.id 1ERC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ERC pdb_00001erc 10.2210/pdb1erc/pdb WWPDB D_1000173130 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-10-15 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' pdbx_entry_details 8 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ERC _pdbx_database_status.recvd_initial_deposition_date 1994-02-14 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mronga, S.' 1 'Luginbuhl, P.' 2 'Brown, L.R.' 3 'Ortenzi, C.' 4 'Luporini, P.' 5 'Bradshaw, R.A.' 6 'Wuthrich, K.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'The NMR solution structure of the pheromone Er-1 from the ciliated protozoan Euplotes raikovi.' 'Protein Sci.' 3 1527 1536 1994 PRCIEI US 0961-8368 0795 ? 7833812 ? 1 ;Primary Structure of Euplotes Raikovi Pheromones: Comparison of Five Sequences of Pheromones from Cells with Variable Mating Interactions ; Proc.Natl.Acad.Sci.USA 89 2071 ? 1992 PNASA6 US 0027-8424 0040 ? ? ? 2 'Primary Structure of the Mating Pheromone Er-1 of the Ciliate Euplotes Raikovi' J.Biol.Chem. 263 18152 ? 1988 JBCHA3 US 0021-9258 0071 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mronga, S.' 1 ? primary 'Luginbuhl, P.' 2 ? primary 'Brown, L.R.' 3 ? primary 'Ortenzi, C.' 4 ? primary 'Luporini, P.' 5 ? primary 'Bradshaw, R.A.' 6 ? primary 'Wuthrich, K.' 7 ? 1 'Raffioni, S.' 8 ? 1 'Miceli, C.' 9 ? 1 'Vallesi, A.' 10 ? 1 'Chowdhury, S.K.' 11 ? 1 'Chait, B.T.' 12 ? 1 'Luporini, P.' 13 ? 1 'Bradshaw, R.A.' 14 ? 2 'Raffioni, S.' 15 ? 2 'Luporini, P.' 16 ? 2 'Chait, B.T.' 17 ? 2 'Disper, S.S.' 18 ? 2 'Bradshaw, R.A.' 19 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PHEROMONE ER-1' _entity.formula_weight 4417.881 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DACEQAAIQCVESACESLCTEGEDRTGCYMYIYSNCPPYV _entity_poly.pdbx_seq_one_letter_code_can DACEQAAIQCVESACESLCTEGEDRTGCYMYIYSNCPPYV _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 ALA n 1 3 CYS n 1 4 GLU n 1 5 GLN n 1 6 ALA n 1 7 ALA n 1 8 ILE n 1 9 GLN n 1 10 CYS n 1 11 VAL n 1 12 GLU n 1 13 SER n 1 14 ALA n 1 15 CYS n 1 16 GLU n 1 17 SER n 1 18 LEU n 1 19 CYS n 1 20 THR n 1 21 GLU n 1 22 GLY n 1 23 GLU n 1 24 ASP n 1 25 ARG n 1 26 THR n 1 27 GLY n 1 28 CYS n 1 29 TYR n 1 30 MET n 1 31 TYR n 1 32 ILE n 1 33 TYR n 1 34 SER n 1 35 ASN n 1 36 CYS n 1 37 PRO n 1 38 PRO n 1 39 TYR n 1 40 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Euplotes _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Euplotes raikovi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5938 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 VAL 40 40 40 VAL VAL A . n # _cell.entry_id 1ERC _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ERC _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1ERC _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1ERC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1ERC _struct.title 'THE NMR SOLUTION STRUCTURE OF THE PHEROMONE ER-1 FROM THE CILIATED PROTOZOAN EUPLOTES RAIKOVI' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ERC _struct_keywords.pdbx_keywords PHEROMONE _struct_keywords.text PHEROMONE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MER1_EUPRA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P10774 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code MNKLAILAIIAMVLFSANAFRFQSRLRSNVEAKTGDACEQAAIQCVESACESLCTEGEDRTGCYMYIYSNCPPYV _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ERC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 40 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P10774 _struct_ref_seq.db_align_beg 36 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 75 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 40 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1H ALA A 2 ? GLN A 9 ? ALA A 2 GLN A 9 1 ? 8 HELX_P HELX_P2 2H GLU A 12 ? CYS A 19 ? GLU A 12 CYS A 19 1 ? 8 HELX_P HELX_P3 3H ASP A 24 ? TYR A 33 ? ASP A 24 TYR A 33 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 19 SG ? ? A CYS 3 A CYS 19 1_555 ? ? ? ? ? ? ? 2.082 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 10 A CYS 36 1_555 ? ? ? ? ? ? ? 2.076 ? ? disulf3 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 15 A CYS 28 1_555 ? ? ? ? ? ? ? 2.075 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 3 ? CYS A 19 ? CYS A 3 ? 1_555 CYS A 19 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 10 ? CYS A 36 ? CYS A 10 ? 1_555 CYS A 36 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 15 ? CYS A 28 ? CYS A 15 ? 1_555 CYS A 28 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 1 -1.80 2 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 2 -1.01 3 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 3 3.23 4 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 4 1.07 5 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 5 -5.20 6 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 6 -2.49 7 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 7 1.93 8 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 8 -3.03 9 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 9 -3.19 10 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 10 7.93 11 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 11 2.25 12 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 12 -3.40 13 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 13 -1.85 14 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 14 -0.58 15 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 15 3.30 16 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 16 9.09 17 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 17 2.59 18 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 18 -4.04 19 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 19 8.65 20 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 20 8.74 # _pdbx_entry_details.entry_id 1ERC _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 CB A TYR 29 ? ? CG A TYR 29 ? ? CD1 A TYR 29 ? ? 116.60 121.00 -4.40 0.60 N 2 3 CB A TYR 29 ? ? CG A TYR 29 ? ? CD1 A TYR 29 ? ? 115.75 121.00 -5.25 0.60 N 3 4 CA A CYS 15 ? ? CB A CYS 15 ? ? SG A CYS 15 ? ? 121.36 114.20 7.16 1.10 N 4 7 CB A TYR 33 ? ? CG A TYR 33 ? ? CD1 A TYR 33 ? ? 117.38 121.00 -3.62 0.60 N 5 8 CA A CYS 10 ? ? CB A CYS 10 ? ? SG A CYS 10 ? ? 121.05 114.20 6.85 1.10 N 6 10 CA A CYS 15 ? ? CB A CYS 15 ? ? SG A CYS 15 ? ? 121.88 114.20 7.68 1.10 N 7 11 CB A TYR 33 ? ? CG A TYR 33 ? ? CD2 A TYR 33 ? ? 116.73 121.00 -4.27 0.60 N 8 14 CB A TYR 29 ? ? CG A TYR 29 ? ? CD1 A TYR 29 ? ? 116.97 121.00 -4.03 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? -161.66 -27.82 2 1 THR A 20 ? ? -61.36 -80.92 3 1 GLU A 21 ? ? 168.17 151.76 4 1 GLU A 23 ? ? 134.80 -60.61 5 1 PRO A 38 ? ? -85.22 30.59 6 1 TYR A 39 ? ? -105.32 -71.58 7 2 ALA A 2 ? ? 69.34 -38.70 8 2 CYS A 10 ? ? 75.68 45.01 9 2 THR A 20 ? ? -70.81 -101.67 10 2 GLU A 21 ? ? 174.57 154.10 11 2 GLU A 23 ? ? -164.35 -53.06 12 3 ALA A 2 ? ? 64.36 -26.28 13 3 CYS A 10 ? ? 77.15 44.56 14 3 THR A 20 ? ? -66.08 -93.84 15 3 GLU A 21 ? ? 175.89 148.52 16 3 GLU A 23 ? ? 140.80 -55.79 17 4 ALA A 2 ? ? 177.77 -66.68 18 4 CYS A 10 ? ? 84.56 57.00 19 4 THR A 20 ? ? -93.03 -93.88 20 4 GLU A 23 ? ? 82.84 -35.36 21 4 TYR A 33 ? ? -59.37 -9.68 22 5 ALA A 2 ? ? -156.13 -72.78 23 5 THR A 20 ? ? -74.24 -82.34 24 5 GLU A 21 ? ? 162.32 159.00 25 5 GLU A 23 ? ? 83.83 -42.67 26 6 ALA A 2 ? ? 168.50 -27.48 27 6 CYS A 10 ? ? 79.96 43.59 28 6 THR A 20 ? ? -70.87 -112.07 29 6 GLU A 23 ? ? -163.83 -55.25 30 7 CYS A 10 ? ? 74.25 57.52 31 7 THR A 20 ? ? -70.01 -93.63 32 7 GLU A 21 ? ? 173.65 163.79 33 7 GLU A 23 ? ? -178.36 -65.02 34 8 CYS A 10 ? ? 79.25 44.46 35 8 THR A 20 ? ? -75.25 -92.02 36 8 GLU A 21 ? ? 178.27 171.50 37 8 GLU A 23 ? ? 176.39 -43.04 38 8 TYR A 31 ? ? -63.33 -72.40 39 8 TYR A 39 ? ? -66.95 -71.77 40 9 LEU A 18 ? ? -154.35 -42.13 41 9 THR A 20 ? ? -88.04 -100.33 42 9 GLU A 23 ? ? 64.13 -17.39 43 9 PRO A 38 ? ? -92.73 36.83 44 10 ALA A 2 ? ? 176.78 -66.46 45 10 THR A 20 ? ? -69.70 -84.32 46 10 GLU A 21 ? ? 165.33 165.14 47 10 GLU A 23 ? ? 101.95 -43.46 48 11 ALA A 2 ? ? -130.53 -63.69 49 11 LEU A 18 ? ? -134.20 -47.29 50 11 THR A 20 ? ? -75.52 -91.96 51 11 GLU A 21 ? ? 163.77 125.09 52 11 GLU A 23 ? ? -163.38 -52.88 53 12 ALA A 2 ? ? 66.49 -26.78 54 12 CYS A 10 ? ? 74.00 49.39 55 12 THR A 20 ? ? -80.51 -97.76 56 12 GLU A 21 ? ? 172.65 107.01 57 12 GLU A 23 ? ? 85.34 -47.54 58 12 PRO A 38 ? ? -85.92 30.88 59 12 TYR A 39 ? ? -98.79 -102.46 60 13 ALA A 2 ? ? -161.91 -86.64 61 13 CYS A 10 ? ? 88.66 52.81 62 13 THR A 20 ? ? -74.58 -119.15 63 13 GLU A 23 ? ? -163.56 -33.53 64 14 CYS A 10 ? ? 72.88 52.41 65 14 SER A 13 ? ? -72.44 39.20 66 14 ALA A 14 ? ? -135.40 -49.56 67 14 THR A 20 ? ? -62.36 -70.54 68 14 GLU A 21 ? ? 145.47 132.78 69 14 GLU A 23 ? ? -163.78 -33.65 70 14 TYR A 39 ? ? -72.49 -87.59 71 15 ALA A 2 ? ? -179.67 -40.17 72 15 SER A 13 ? ? -76.33 23.99 73 15 THR A 20 ? ? -73.07 -137.11 74 15 GLU A 23 ? ? 147.54 -70.69 75 16 ALA A 2 ? ? 70.66 -47.53 76 16 CYS A 10 ? ? 72.92 49.86 77 16 SER A 17 ? ? -94.28 42.40 78 16 LEU A 18 ? ? -154.85 -59.35 79 16 THR A 20 ? ? -63.80 -88.02 80 16 GLU A 21 ? ? 164.31 159.61 81 16 GLU A 23 ? ? -168.89 -55.33 82 17 ALA A 2 ? ? 163.10 -36.76 83 17 CYS A 10 ? ? 76.76 49.85 84 17 LEU A 18 ? ? -151.98 -33.51 85 17 THR A 20 ? ? -71.37 -70.52 86 17 GLU A 21 ? ? 148.20 119.86 87 17 GLU A 23 ? ? 80.40 -46.67 88 18 ALA A 2 ? ? -156.05 -43.55 89 18 CYS A 10 ? ? 71.48 49.10 90 18 SER A 13 ? ? -75.52 37.13 91 18 THR A 20 ? ? -70.82 -89.07 92 18 GLU A 21 ? ? 171.74 150.71 93 18 GLU A 23 ? ? 92.17 -45.21 94 18 PRO A 38 ? ? -91.18 41.38 95 19 CYS A 10 ? ? 73.80 51.07 96 19 LEU A 18 ? ? -92.58 -65.16 97 19 GLU A 21 ? ? 149.87 146.48 98 19 GLU A 23 ? ? -163.67 -41.66 99 19 TYR A 31 ? ? -54.81 -72.01 100 19 TYR A 39 ? ? -89.76 -73.37 101 20 ALA A 2 ? ? 62.64 -28.49 102 20 CYS A 10 ? ? 74.47 46.03 103 20 SER A 17 ? ? -105.12 42.02 104 20 LEU A 18 ? ? -131.22 -56.27 105 20 THR A 20 ? ? -65.44 -93.56 106 20 GLU A 21 ? ? 156.35 123.59 107 20 GLU A 23 ? ? -162.72 -43.71 108 20 ASN A 35 ? ? -134.27 -36.52 109 20 TYR A 39 ? ? -75.68 -71.32 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 33 ? ? 0.153 'SIDE CHAIN' 2 2 ARG A 25 ? ? 0.146 'SIDE CHAIN' 3 2 TYR A 29 ? ? 0.126 'SIDE CHAIN' 4 2 TYR A 31 ? ? 0.090 'SIDE CHAIN' 5 3 TYR A 29 ? ? 0.210 'SIDE CHAIN' 6 3 TYR A 31 ? ? 0.080 'SIDE CHAIN' 7 3 TYR A 33 ? ? 0.247 'SIDE CHAIN' 8 4 TYR A 39 ? ? 0.072 'SIDE CHAIN' 9 5 TYR A 29 ? ? 0.153 'SIDE CHAIN' 10 5 TYR A 31 ? ? 0.103 'SIDE CHAIN' 11 5 TYR A 39 ? ? 0.069 'SIDE CHAIN' 12 6 TYR A 29 ? ? 0.068 'SIDE CHAIN' 13 6 TYR A 31 ? ? 0.077 'SIDE CHAIN' 14 6 TYR A 33 ? ? 0.109 'SIDE CHAIN' 15 7 ARG A 25 ? ? 0.079 'SIDE CHAIN' 16 7 TYR A 29 ? ? 0.129 'SIDE CHAIN' 17 7 TYR A 33 ? ? 0.186 'SIDE CHAIN' 18 7 TYR A 39 ? ? 0.074 'SIDE CHAIN' 19 8 ARG A 25 ? ? 0.151 'SIDE CHAIN' 20 8 TYR A 33 ? ? 0.172 'SIDE CHAIN' 21 9 TYR A 29 ? ? 0.171 'SIDE CHAIN' 22 9 TYR A 33 ? ? 0.216 'SIDE CHAIN' 23 10 TYR A 33 ? ? 0.079 'SIDE CHAIN' 24 11 ARG A 25 ? ? 0.105 'SIDE CHAIN' 25 11 TYR A 33 ? ? 0.169 'SIDE CHAIN' 26 11 TYR A 39 ? ? 0.104 'SIDE CHAIN' 27 12 TYR A 29 ? ? 0.098 'SIDE CHAIN' 28 12 TYR A 33 ? ? 0.132 'SIDE CHAIN' 29 13 TYR A 39 ? ? 0.092 'SIDE CHAIN' 30 14 TYR A 31 ? ? 0.112 'SIDE CHAIN' 31 14 TYR A 33 ? ? 0.137 'SIDE CHAIN' 32 14 TYR A 39 ? ? 0.121 'SIDE CHAIN' 33 15 TYR A 29 ? ? 0.103 'SIDE CHAIN' 34 15 TYR A 33 ? ? 0.081 'SIDE CHAIN' 35 17 TYR A 31 ? ? 0.155 'SIDE CHAIN' 36 18 TYR A 29 ? ? 0.077 'SIDE CHAIN' 37 18 TYR A 31 ? ? 0.063 'SIDE CHAIN' 38 19 TYR A 29 ? ? 0.083 'SIDE CHAIN' 39 19 TYR A 31 ? ? 0.085 'SIDE CHAIN' 40 19 TYR A 33 ? ? 0.082 'SIDE CHAIN' 41 20 TYR A 29 ? ? 0.083 'SIDE CHAIN' 42 20 TYR A 39 ? ? 0.085 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1ERC _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 MET N N N N 181 MET CA C N S 182 MET C C N N 183 MET O O N N 184 MET CB C N N 185 MET CG C N N 186 MET SD S N N 187 MET CE C N N 188 MET OXT O N N 189 MET H H N N 190 MET H2 H N N 191 MET HA H N N 192 MET HB2 H N N 193 MET HB3 H N N 194 MET HG2 H N N 195 MET HG3 H N N 196 MET HE1 H N N 197 MET HE2 H N N 198 MET HE3 H N N 199 MET HXT H N N 200 PRO N N N N 201 PRO CA C N S 202 PRO C C N N 203 PRO O O N N 204 PRO CB C N N 205 PRO CG C N N 206 PRO CD C N N 207 PRO OXT O N N 208 PRO H H N N 209 PRO HA H N N 210 PRO HB2 H N N 211 PRO HB3 H N N 212 PRO HG2 H N N 213 PRO HG3 H N N 214 PRO HD2 H N N 215 PRO HD3 H N N 216 PRO HXT H N N 217 SER N N N N 218 SER CA C N S 219 SER C C N N 220 SER O O N N 221 SER CB C N N 222 SER OG O N N 223 SER OXT O N N 224 SER H H N N 225 SER H2 H N N 226 SER HA H N N 227 SER HB2 H N N 228 SER HB3 H N N 229 SER HG H N N 230 SER HXT H N N 231 THR N N N N 232 THR CA C N S 233 THR C C N N 234 THR O O N N 235 THR CB C N R 236 THR OG1 O N N 237 THR CG2 C N N 238 THR OXT O N N 239 THR H H N N 240 THR H2 H N N 241 THR HA H N N 242 THR HB H N N 243 THR HG1 H N N 244 THR HG21 H N N 245 THR HG22 H N N 246 THR HG23 H N N 247 THR HXT H N N 248 TYR N N N N 249 TYR CA C N S 250 TYR C C N N 251 TYR O O N N 252 TYR CB C N N 253 TYR CG C Y N 254 TYR CD1 C Y N 255 TYR CD2 C Y N 256 TYR CE1 C Y N 257 TYR CE2 C Y N 258 TYR CZ C Y N 259 TYR OH O N N 260 TYR OXT O N N 261 TYR H H N N 262 TYR H2 H N N 263 TYR HA H N N 264 TYR HB2 H N N 265 TYR HB3 H N N 266 TYR HD1 H N N 267 TYR HD2 H N N 268 TYR HE1 H N N 269 TYR HE2 H N N 270 TYR HH H N N 271 TYR HXT H N N 272 VAL N N N N 273 VAL CA C N S 274 VAL C C N N 275 VAL O O N N 276 VAL CB C N N 277 VAL CG1 C N N 278 VAL CG2 C N N 279 VAL OXT O N N 280 VAL H H N N 281 VAL H2 H N N 282 VAL HA H N N 283 VAL HB H N N 284 VAL HG11 H N N 285 VAL HG12 H N N 286 VAL HG13 H N N 287 VAL HG21 H N N 288 VAL HG22 H N N 289 VAL HG23 H N N 290 VAL HXT H N N 291 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 MET N CA sing N N 171 MET N H sing N N 172 MET N H2 sing N N 173 MET CA C sing N N 174 MET CA CB sing N N 175 MET CA HA sing N N 176 MET C O doub N N 177 MET C OXT sing N N 178 MET CB CG sing N N 179 MET CB HB2 sing N N 180 MET CB HB3 sing N N 181 MET CG SD sing N N 182 MET CG HG2 sing N N 183 MET CG HG3 sing N N 184 MET SD CE sing N N 185 MET CE HE1 sing N N 186 MET CE HE2 sing N N 187 MET CE HE3 sing N N 188 MET OXT HXT sing N N 189 PRO N CA sing N N 190 PRO N CD sing N N 191 PRO N H sing N N 192 PRO CA C sing N N 193 PRO CA CB sing N N 194 PRO CA HA sing N N 195 PRO C O doub N N 196 PRO C OXT sing N N 197 PRO CB CG sing N N 198 PRO CB HB2 sing N N 199 PRO CB HB3 sing N N 200 PRO CG CD sing N N 201 PRO CG HG2 sing N N 202 PRO CG HG3 sing N N 203 PRO CD HD2 sing N N 204 PRO CD HD3 sing N N 205 PRO OXT HXT sing N N 206 SER N CA sing N N 207 SER N H sing N N 208 SER N H2 sing N N 209 SER CA C sing N N 210 SER CA CB sing N N 211 SER CA HA sing N N 212 SER C O doub N N 213 SER C OXT sing N N 214 SER CB OG sing N N 215 SER CB HB2 sing N N 216 SER CB HB3 sing N N 217 SER OG HG sing N N 218 SER OXT HXT sing N N 219 THR N CA sing N N 220 THR N H sing N N 221 THR N H2 sing N N 222 THR CA C sing N N 223 THR CA CB sing N N 224 THR CA HA sing N N 225 THR C O doub N N 226 THR C OXT sing N N 227 THR CB OG1 sing N N 228 THR CB CG2 sing N N 229 THR CB HB sing N N 230 THR OG1 HG1 sing N N 231 THR CG2 HG21 sing N N 232 THR CG2 HG22 sing N N 233 THR CG2 HG23 sing N N 234 THR OXT HXT sing N N 235 TYR N CA sing N N 236 TYR N H sing N N 237 TYR N H2 sing N N 238 TYR CA C sing N N 239 TYR CA CB sing N N 240 TYR CA HA sing N N 241 TYR C O doub N N 242 TYR C OXT sing N N 243 TYR CB CG sing N N 244 TYR CB HB2 sing N N 245 TYR CB HB3 sing N N 246 TYR CG CD1 doub Y N 247 TYR CG CD2 sing Y N 248 TYR CD1 CE1 sing Y N 249 TYR CD1 HD1 sing N N 250 TYR CD2 CE2 doub Y N 251 TYR CD2 HD2 sing N N 252 TYR CE1 CZ doub Y N 253 TYR CE1 HE1 sing N N 254 TYR CE2 CZ sing Y N 255 TYR CE2 HE2 sing N N 256 TYR CZ OH sing N N 257 TYR OH HH sing N N 258 TYR OXT HXT sing N N 259 VAL N CA sing N N 260 VAL N H sing N N 261 VAL N H2 sing N N 262 VAL CA C sing N N 263 VAL CA CB sing N N 264 VAL CA HA sing N N 265 VAL C O doub N N 266 VAL C OXT sing N N 267 VAL CB CG1 sing N N 268 VAL CB CG2 sing N N 269 VAL CB HB sing N N 270 VAL CG1 HG11 sing N N 271 VAL CG1 HG12 sing N N 272 VAL CG1 HG13 sing N N 273 VAL CG2 HG21 sing N N 274 VAL CG2 HG22 sing N N 275 VAL CG2 HG23 sing N N 276 VAL OXT HXT sing N N 277 # _atom_sites.entry_id 1ERC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # _atom_sites_footnote.id 1 _atom_sites_footnote.text 'CIS PROLINE - PRO 38' # loop_ _atom_type.symbol C H N O S # loop_