data_1ERH # _entry.id 1ERH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1ERH WWPDB D_1000173134 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1ERG _pdbx_database_related.details . _pdbx_database_related.content_type 'representative structure' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ERH _pdbx_database_status.recvd_initial_deposition_date 1993-12-13 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kieffer, B.' 1 'Driscoll, P.C.' 2 'Campbell, I.D.' 3 'Willis, A.C.' 4 'Van Der Merwe, P.A.' 5 'Davis, S.J.' 6 # _citation.id primary _citation.title ;Three-dimensional solution structure of the extracellular region of the complement regulatory protein CD59, a new cell-surface protein domain related to snake venom neurotoxins. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 33 _citation.page_first 4471 _citation.page_last 4482 _citation.year 1994 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 7512825 _citation.pdbx_database_id_DOI 10.1021/bi00181a006 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kieffer, B.' 1 primary 'Driscoll, P.C.' 2 primary 'Campbell, I.D.' 3 primary 'Willis, A.C.' 4 primary 'van der Merwe, P.A.' 5 primary 'Davis, S.J.' 6 # _cell.entry_id 1ERH _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ERH _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description CD59 _entity.formula_weight 8095.213 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCN _entity_poly.pdbx_seq_one_letter_code_can LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 GLN n 1 3 CYS n 1 4 TYR n 1 5 ASN n 1 6 CYS n 1 7 PRO n 1 8 ASN n 1 9 PRO n 1 10 THR n 1 11 ALA n 1 12 ASP n 1 13 CYS n 1 14 LYS n 1 15 THR n 1 16 ALA n 1 17 VAL n 1 18 ASN n 1 19 CYS n 1 20 SER n 1 21 SER n 1 22 ASP n 1 23 PHE n 1 24 ASP n 1 25 ALA n 1 26 CYS n 1 27 LEU n 1 28 ILE n 1 29 THR n 1 30 LYS n 1 31 ALA n 1 32 GLY n 1 33 LEU n 1 34 GLN n 1 35 VAL n 1 36 TYR n 1 37 ASN n 1 38 LYS n 1 39 CYS n 1 40 TRP n 1 41 LYS n 1 42 PHE n 1 43 GLU n 1 44 HIS n 1 45 CYS n 1 46 ASN n 1 47 PHE n 1 48 ASN n 1 49 ASP n 1 50 VAL n 1 51 THR n 1 52 THR n 1 53 ARG n 1 54 LEU n 1 55 ARG n 1 56 GLU n 1 57 ASN n 1 58 GLU n 1 59 LEU n 1 60 THR n 1 61 TYR n 1 62 TYR n 1 63 CYS n 1 64 CYS n 1 65 LYS n 1 66 LYS n 1 67 ASP n 1 68 LEU n 1 69 CYS n 1 70 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CD59_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P13987 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLR ENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ERH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P13987 _struct_ref_seq.db_align_beg 26 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 95 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 70 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1ERH _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1ERH _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1ERH _struct.title ;THREE-DIMENSIONAL SOLUTION STRUCTURE OF THE EXTRACELLULAR REGION OF THE COMPLEMENT REGULATORY PROTEIN, CD59, A NEW CELL SURFACE PROTEIN DOMAIN RELATED TO NEUROTOXINS ; _struct.pdbx_descriptor 'HUMAN COMPLEMENT REGULATORY PROTEIN CD59 (EXTRACELLULAR REGION, RESIDUES 1 - 70) (NMR, 10 STRUCTURES)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ERH _struct_keywords.pdbx_keywords 'COMPLEMENT FACTOR' _struct_keywords.text 'COMPLEMENT FACTOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id H1 _struct_conf.beg_label_comp_id PHE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 47 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 54 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PHE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 47 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 54 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details '1/5 NOT WELL-DEFINED BY NMR' _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details B1 ? 2 ? B2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense B1 1 2 ? anti-parallel B2 1 2 ? anti-parallel B2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id B1 1 CYS A 3 ? ASN A 5 ? CYS A 3 ASN A 5 B1 2 THR A 15 ? VAL A 17 ? THR A 15 VAL A 17 B2 1 TYR A 36 ? TRP A 40 ? TYR A 36 TRP A 40 B2 2 ALA A 25 ? LYS A 30 ? ALA A 25 LYS A 30 B2 3 TYR A 62 ? CYS A 64 ? TYR A 62 CYS A 64 # _struct_site.id PYB _struct_site.pdbx_evidence_code Unknown _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details ? # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 PYB 3 THR A 29 ? THR A 29 . ? 1_555 ? 2 PYB 3 PHE A 47 ? PHE A 47 . ? 1_555 ? 3 PYB 3 CYS A 69 ? CYS A 69 . ? 1_555 ? # _database_PDB_matrix.entry_id 1ERH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ERH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # _atom_type.symbol C # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 ASN 70 70 70 ASN ASN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-04-30 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _pdbx_coordinate_model.asym_id A _pdbx_coordinate_model.type 'CA ATOMS ONLY' #