data_1EST # _entry.id 1EST # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1EST WWPDB D_1000173155 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1EST _pdbx_database_status.recvd_initial_deposition_date 1976-05-17 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sawyer, L.' 1 'Shotton, D.M.' 2 'Watson, H.C.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;The atomic structure of crystalline porcine pancreatic elastase at 2.5 A resolution: comparisons with the structure of alpha-chymotrypsin. ; J.Mol.Biol. 118 137 208 1978 JMOBAK UK 0022-2836 0070 ? 628010 '10.1016/0022-2836(78)90412-6' 1 'Atomic Coordinates for Tosyl-Elastase' Biochem.Biophys.Res.Commun. 53 944 ? 1973 BBRCA9 US 0006-291X 0146 ? ? ? 2 'Amino-Acid Sequence of Porcine Pancreatic Elastase and its Homologies with Other Serine Proteinases' Nature 225 802 ? 1970 NATUAS UK 0028-0836 0006 ? ? ? 3 'Three-Dimensional Fourier Synthesis of Tosyl-Elastase at 3.5 Angstroms Resolution' Nature 225 806 ? 1970 NATUAS UK 0028-0836 0006 ? ? ? 4 'Three Dimensional Structure of Tosyl-Elastase' Nature 225 811 ? 1970 NATUAS UK 0028-0836 0006 ? ? ? 5 ? 'Atlas of Macromolecular Structure on Microfiche' ? 233 ? 1976 ? ? 0-917934-01-6 0434 'Tracor Jitco,Inc.,Rockville,Md.' ? ? 6 ? 'Atlas of Protein Sequence and Structure,Supplement 2' 5 96 ? 1976 ? ? 0-912466-05-7 435 'National Biomedical Research Foundation, Silver Spring,Md.' ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Sawyer, L.' 1 primary 'Shotton, D.M.' 2 primary 'Campbell, J.W.' 3 primary 'Wendell, P.L.' 4 primary 'Muirhead, H.' 5 primary 'Watson, H.C.' 6 primary 'Diamond, R.' 7 primary 'Ladner, R.C.' 8 1 'Sawyer, L.' 9 1 'Shotton, D.M.' 10 1 'Watson, H.C.' 11 2 'Shotton, D.M.' 12 2 'Hartley, B.S.' 13 3 'Watson, H.C.' 14 3 'Shotton, D.M.' 15 3 'Cox, J.M.' 16 3 'Muirhead, H.' 17 4 'Shotton, D.M.' 18 4 'Watson, H.C.' 19 # loop_ _citation_editor.citation_id _citation_editor.name _citation_editor.ordinal 5 'Feldmann, R.J.' 1 6 'Dayhoff, M.O.' 2 # _cell.entry_id 1EST _cell.length_a 51.500 _cell.length_b 58.000 _cell.length_c 75.500 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1EST _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PORCINE PANCREATIC ELASTASE' 25928.031 1 3.4.21.36 ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn 'PARA-TOLUENE SULFONATE' 172.202 1 ? ? ? ? 4 water nat water 18.015 25 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVH PYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSS SSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN ; _entity_poly.pdbx_seq_one_letter_code_can ;VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVH PYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSS SSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 VAL n 1 3 GLY n 1 4 GLY n 1 5 THR n 1 6 GLU n 1 7 ALA n 1 8 GLN n 1 9 ARG n 1 10 ASN n 1 11 SER n 1 12 TRP n 1 13 PRO n 1 14 SER n 1 15 GLN n 1 16 ILE n 1 17 SER n 1 18 LEU n 1 19 GLN n 1 20 TYR n 1 21 ARG n 1 22 SER n 1 23 GLY n 1 24 SER n 1 25 SER n 1 26 TRP n 1 27 ALA n 1 28 HIS n 1 29 THR n 1 30 CYS n 1 31 GLY n 1 32 GLY n 1 33 THR n 1 34 LEU n 1 35 ILE n 1 36 ARG n 1 37 GLN n 1 38 ASN n 1 39 TRP n 1 40 VAL n 1 41 MET n 1 42 THR n 1 43 ALA n 1 44 ALA n 1 45 HIS n 1 46 CYS n 1 47 VAL n 1 48 ASP n 1 49 ARG n 1 50 GLU n 1 51 LEU n 1 52 THR n 1 53 PHE n 1 54 ARG n 1 55 VAL n 1 56 VAL n 1 57 VAL n 1 58 GLY n 1 59 GLU n 1 60 HIS n 1 61 ASN n 1 62 LEU n 1 63 ASN n 1 64 GLN n 1 65 ASN n 1 66 ASN n 1 67 GLY n 1 68 THR n 1 69 GLU n 1 70 GLN n 1 71 TYR n 1 72 VAL n 1 73 GLY n 1 74 VAL n 1 75 GLN n 1 76 LYS n 1 77 ILE n 1 78 VAL n 1 79 VAL n 1 80 HIS n 1 81 PRO n 1 82 TYR n 1 83 TRP n 1 84 ASN n 1 85 THR n 1 86 ASP n 1 87 ASP n 1 88 VAL n 1 89 ALA n 1 90 ALA n 1 91 GLY n 1 92 TYR n 1 93 ASP n 1 94 ILE n 1 95 ALA n 1 96 LEU n 1 97 LEU n 1 98 ARG n 1 99 LEU n 1 100 ALA n 1 101 GLN n 1 102 SER n 1 103 VAL n 1 104 THR n 1 105 LEU n 1 106 ASN n 1 107 SER n 1 108 TYR n 1 109 VAL n 1 110 GLN n 1 111 LEU n 1 112 GLY n 1 113 VAL n 1 114 LEU n 1 115 PRO n 1 116 ARG n 1 117 ALA n 1 118 GLY n 1 119 THR n 1 120 ILE n 1 121 LEU n 1 122 ALA n 1 123 ASN n 1 124 ASN n 1 125 SER n 1 126 PRO n 1 127 CYS n 1 128 TYR n 1 129 ILE n 1 130 THR n 1 131 GLY n 1 132 TRP n 1 133 GLY n 1 134 LEU n 1 135 THR n 1 136 ARG n 1 137 THR n 1 138 ASN n 1 139 GLY n 1 140 GLN n 1 141 LEU n 1 142 ALA n 1 143 GLN n 1 144 THR n 1 145 LEU n 1 146 GLN n 1 147 GLN n 1 148 ALA n 1 149 TYR n 1 150 LEU n 1 151 PRO n 1 152 THR n 1 153 VAL n 1 154 ASP n 1 155 TYR n 1 156 ALA n 1 157 ILE n 1 158 CYS n 1 159 SER n 1 160 SER n 1 161 SER n 1 162 SER n 1 163 TYR n 1 164 TRP n 1 165 GLY n 1 166 SER n 1 167 THR n 1 168 VAL n 1 169 LYS n 1 170 ASN n 1 171 SER n 1 172 MET n 1 173 VAL n 1 174 CYS n 1 175 ALA n 1 176 GLY n 1 177 GLY n 1 178 ASP n 1 179 GLY n 1 180 VAL n 1 181 ARG n 1 182 SER n 1 183 GLY n 1 184 CYS n 1 185 GLN n 1 186 GLY n 1 187 ASP n 1 188 SER n 1 189 GLY n 1 190 GLY n 1 191 PRO n 1 192 LEU n 1 193 HIS n 1 194 CYS n 1 195 LEU n 1 196 VAL n 1 197 ASN n 1 198 GLY n 1 199 GLN n 1 200 TYR n 1 201 ALA n 1 202 VAL n 1 203 HIS n 1 204 GLY n 1 205 VAL n 1 206 THR n 1 207 SER n 1 208 PHE n 1 209 VAL n 1 210 SER n 1 211 ARG n 1 212 LEU n 1 213 GLY n 1 214 CYS n 1 215 ASN n 1 216 VAL n 1 217 THR n 1 218 ARG n 1 219 LYS n 1 220 PRO n 1 221 THR n 1 222 VAL n 1 223 PHE n 1 224 THR n 1 225 ARG n 1 226 VAL n 1 227 SER n 1 228 ALA n 1 229 TYR n 1 230 ILE n 1 231 SER n 1 232 TRP n 1 233 ILE n 1 234 ASN n 1 235 ASN n 1 236 VAL n 1 237 ILE n 1 238 ALA n 1 239 SER n 1 240 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name pig _entity_src_gen.gene_src_genus Sus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sus scrofa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9823 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ELA1_PIG _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00772 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MLRLLVVASLVLYGHSTQDFPETNARVVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFR VVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGL TRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGC NVTRKPTVFTRVSAYISWINNVIASN ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1EST _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 240 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00772 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 266 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 16 _struct_ref_seq.pdbx_auth_seq_align_end 245 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1EST _struct_ref_seq_dif.mon_id ASN _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 66 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P00772 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 92 _struct_ref_seq_dif.details CONFLICT _struct_ref_seq_dif.pdbx_auth_seq_num 77 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TSU non-polymer . 'PARA-TOLUENE SULFONATE' ? 'C7 H8 O3 S' 172.202 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1EST _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.17 _exptl_crystal.density_percent_sol 43.42 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine.entry_id 1EST _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high 2.5 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ;COORDINATES FOR THE 27 WATER MOLECULES AND 1 SULPHATE ION WERE TAKEN FROM THE ARTICLE CITED AS REFERENCE 1. ; _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_phase_error ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1822 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.number_atoms_solvent 25 _refine_hist.number_atoms_total 1858 _refine_hist.d_res_high 2.5 _refine_hist.d_res_low . # _struct.entry_id 1EST _struct.title ;THE ATOMIC STRUCTURE OF CRYSTALLINE PORCINE PANCREATIC ELASTASE AT 2.5 ANGSTROMS RESOLUTION. COMPARISONS WITH THE STRUCTURE OF ALPHA-CHYMOTRYPSIN ; _struct.pdbx_descriptor 'TOSYL-ELASTASE (E.C.3.4.21.11)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1EST _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'HYDROLASE (SERINE PROTEINASE), HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 HA ASP A 154 ? SER A 160 ? ASP A 164 SER A 170 1 ? 7 HELX_P HELX_P2 HB TYR A 229 ? ASN A 240 ? TYR A 234 ASN A 245 1 'HELICAL TAIL AT CARBOXY END' 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 46 SG ? ? A CYS 42 A CYS 58 1_555 ? ? ? ? ? ? ? 2.033 ? disulf2 disulf ? ? A CYS 127 SG ? ? ? 1_555 A CYS 194 SG ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.038 ? disulf3 disulf ? ? A CYS 158 SG ? ? ? 1_555 A CYS 174 SG ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.031 ? disulf4 disulf ? ? A CYS 184 SG ? ? ? 1_555 A CYS 214 SG ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 2.034 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 7 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 14 ? SER A 22 A SER A 29 SER A 36 A 2 SER A 25 ? ILE A 35 ? SER A 37 ILE A 47 A 3 ASN A 38 ? ALA A 44 ? ASN A 50 ALA A 56 A 4 ASP A 93 ? GLN A 101 ? ASP A 102 GLN A 110 A 5 GLU A 69 ? HIS A 80 ? GLU A 80 HIS A 91 A 6 PHE A 53 ? GLY A 58 ? PHE A 65 GLY A 69 A 7 SER A 14 ? SER A 22 A SER A 29 SER A 36 B 1 ASN A 124 ? THR A 135 ? ASN A 133 THR A 144 B 2 GLY A 139 ? VAL A 153 ? GLY A 149 VAL A 163 B 3 SER A 171 ? VAL A 180 ? SER A 179 VAL A 188 B 4 ASN A 215 ? VAL A 226 ? ASN A 221 VAL A 231 B 5 HIS A 203 ? VAL A 209 ? HIS A 210 VAL A 216 B 6 SER A 188 ? CYS A 194 ? SER A 195 CYS A 201 B 7 ASN A 124 ? THR A 135 ? ASN A 133 THR A 144 C 1 GLY A 139 ? ALA A 142 ? GLY A 149 ALA A 152 C 2 TRP A 132 ? LEU A 134 ? TRP A 141 LEU A 143 C 3 GLN A 185 ? ASP A 187 ? GLN A 192 ASP A 194 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details CAT Unknown ? ? ? ? 3 ? AC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SO4 A 246' AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE TOS A 247' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 CAT 3 HIS A 45 ? HIS A 57 . ? 1_555 ? 2 CAT 3 ASP A 93 ? ASP A 102 . ? 1_555 ? 3 CAT 3 SER A 188 ? SER A 195 . ? 1_555 ? 4 AC1 1 ARG A 225 ? ARG A 230 . ? 1_555 ? 5 AC2 5 CYS A 184 ? CYS A 191 . ? 1_555 ? 6 AC2 5 GLN A 185 ? GLN A 192 . ? 1_555 ? 7 AC2 5 GLY A 186 ? GLY A 193 . ? 1_555 ? 8 AC2 5 SER A 188 ? SER A 195 . ? 1_555 ? 9 AC2 5 SER A 207 ? SER A 214 . ? 1_555 ? # _database_PDB_matrix.entry_id 1EST _database_PDB_matrix.origx[1][1] 1.00000 _database_PDB_matrix.origx[1][2] 0.00000 _database_PDB_matrix.origx[1][3] 0.00000 _database_PDB_matrix.origx[2][1] 0.00000 _database_PDB_matrix.origx[2][2] 1.00000 _database_PDB_matrix.origx[2][3] 0.00000 _database_PDB_matrix.origx[3][1] 0.00000 _database_PDB_matrix.origx[3][2] 0.00000 _database_PDB_matrix.origx[3][3] 1.00000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1EST _atom_sites.fract_transf_matrix[1][1] 0.019417 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017241 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013245 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # _atom_sites_footnote.id 1 _atom_sites_footnote.text ;RESIDUE SER 195 (THE CATALYTICALLY ACTIVE SERINE ) HAS BEEN TOSYLATED IN THIS STRUCTURE. COORDINATES FOR THE TOSYL GROUP ARE GIVEN IN THE HETATM RECORDS BELOW. ; # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 16 16 VAL VAL A . n A 1 2 VAL 2 17 17 VAL VAL A . n A 1 3 GLY 3 18 18 GLY GLY A . n A 1 4 GLY 4 19 19 GLY GLY A . n A 1 5 THR 5 20 20 THR THR A . n A 1 6 GLU 6 21 21 GLU GLU A . n A 1 7 ALA 7 22 22 ALA ALA A . n A 1 8 GLN 8 23 23 GLN GLN A . n A 1 9 ARG 9 24 24 ARG ARG A . n A 1 10 ASN 10 25 25 ASN ASN A . n A 1 11 SER 11 26 26 SER SER A . n A 1 12 TRP 12 27 27 TRP TRP A . n A 1 13 PRO 13 28 28 PRO PRO A . n A 1 14 SER 14 29 29 SER SER A . n A 1 15 GLN 15 30 30 GLN GLN A . n A 1 16 ILE 16 31 31 ILE ILE A . n A 1 17 SER 17 32 32 SER SER A . n A 1 18 LEU 18 33 33 LEU LEU A . n A 1 19 GLN 19 34 34 GLN GLN A . n A 1 20 TYR 20 35 35 TYR TYR A . n A 1 21 ARG 21 36 36 ARG ARG A . n A 1 22 SER 22 36 36 SER SER A A n A 1 23 GLY 23 36 36 GLY GLY A B n A 1 24 SER 24 36 36 SER SER A C n A 1 25 SER 25 37 37 SER SER A . n A 1 26 TRP 26 38 38 TRP TRP A . n A 1 27 ALA 27 39 39 ALA ALA A . n A 1 28 HIS 28 40 40 HIS HIS A . n A 1 29 THR 29 41 41 THR THR A . n A 1 30 CYS 30 42 42 CYS CYS A . n A 1 31 GLY 31 43 43 GLY GLY A . n A 1 32 GLY 32 44 44 GLY GLY A . n A 1 33 THR 33 45 45 THR THR A . n A 1 34 LEU 34 46 46 LEU LEU A . n A 1 35 ILE 35 47 47 ILE ILE A . n A 1 36 ARG 36 48 48 ARG ARG A . n A 1 37 GLN 37 49 49 GLN GLN A . n A 1 38 ASN 38 50 50 ASN ASN A . n A 1 39 TRP 39 51 51 TRP TRP A . n A 1 40 VAL 40 52 52 VAL VAL A . n A 1 41 MET 41 53 53 MET MET A . n A 1 42 THR 42 54 54 THR THR A . n A 1 43 ALA 43 55 55 ALA ALA A . n A 1 44 ALA 44 56 56 ALA ALA A . n A 1 45 HIS 45 57 57 HIS HIS A . n A 1 46 CYS 46 58 58 CYS CYS A . n A 1 47 VAL 47 59 59 VAL VAL A . n A 1 48 ASP 48 60 60 ASP ASP A . n A 1 49 ARG 49 61 61 ARG ARG A . n A 1 50 GLU 50 62 62 GLU GLU A . n A 1 51 LEU 51 63 63 LEU LEU A . n A 1 52 THR 52 64 64 THR THR A . n A 1 53 PHE 53 65 65 PHE PHE A . n A 1 54 ARG 54 65 65 ARG ARG A A n A 1 55 VAL 55 66 66 VAL VAL A . n A 1 56 VAL 56 67 67 VAL VAL A . n A 1 57 VAL 57 68 68 VAL VAL A . n A 1 58 GLY 58 69 69 GLY GLY A . n A 1 59 GLU 59 70 70 GLU GLU A . n A 1 60 HIS 60 71 71 HIS HIS A . n A 1 61 ASN 61 72 72 ASN ASN A . n A 1 62 LEU 62 73 73 LEU LEU A . n A 1 63 ASN 63 74 74 ASN ASN A . n A 1 64 GLN 64 75 75 GLN GLN A . n A 1 65 ASN 65 76 76 ASN ASN A . n A 1 66 ASN 66 77 77 ASN ASN A . n A 1 67 GLY 67 78 78 GLY GLY A . n A 1 68 THR 68 79 79 THR THR A . n A 1 69 GLU 69 80 80 GLU GLU A . n A 1 70 GLN 70 81 81 GLN GLN A . n A 1 71 TYR 71 82 82 TYR TYR A . n A 1 72 VAL 72 83 83 VAL VAL A . n A 1 73 GLY 73 84 84 GLY GLY A . n A 1 74 VAL 74 85 85 VAL VAL A . n A 1 75 GLN 75 86 86 GLN GLN A . n A 1 76 LYS 76 87 87 LYS LYS A . n A 1 77 ILE 77 88 88 ILE ILE A . n A 1 78 VAL 78 89 89 VAL VAL A . n A 1 79 VAL 79 90 90 VAL VAL A . n A 1 80 HIS 80 91 91 HIS HIS A . n A 1 81 PRO 81 92 92 PRO PRO A . n A 1 82 TYR 82 93 93 TYR TYR A . n A 1 83 TRP 83 94 94 TRP TRP A . n A 1 84 ASN 84 95 95 ASN ASN A . n A 1 85 THR 85 96 96 THR THR A . n A 1 86 ASP 86 97 97 ASP ASP A . n A 1 87 ASP 87 98 98 ASP ASP A . n A 1 88 VAL 88 99 99 VAL VAL A . n A 1 89 ALA 89 99 99 ALA ALA A A n A 1 90 ALA 90 99 99 ALA ALA A B n A 1 91 GLY 91 100 100 GLY GLY A . n A 1 92 TYR 92 101 101 TYR TYR A . n A 1 93 ASP 93 102 102 ASP ASP A . n A 1 94 ILE 94 103 103 ILE ILE A . n A 1 95 ALA 95 104 104 ALA ALA A . n A 1 96 LEU 96 105 105 LEU LEU A . n A 1 97 LEU 97 106 106 LEU LEU A . n A 1 98 ARG 98 107 107 ARG ARG A . n A 1 99 LEU 99 108 108 LEU LEU A . n A 1 100 ALA 100 109 109 ALA ALA A . n A 1 101 GLN 101 110 110 GLN GLN A . n A 1 102 SER 102 111 111 SER SER A . n A 1 103 VAL 103 112 112 VAL VAL A . n A 1 104 THR 104 113 113 THR THR A . n A 1 105 LEU 105 114 114 LEU LEU A . n A 1 106 ASN 106 115 115 ASN ASN A . n A 1 107 SER 107 116 116 SER SER A . n A 1 108 TYR 108 117 117 TYR TYR A . n A 1 109 VAL 109 118 118 VAL VAL A . n A 1 110 GLN 110 119 119 GLN GLN A . n A 1 111 LEU 111 120 120 LEU LEU A . n A 1 112 GLY 112 121 121 GLY GLY A . n A 1 113 VAL 113 122 122 VAL VAL A . n A 1 114 LEU 114 123 123 LEU LEU A . n A 1 115 PRO 115 124 124 PRO PRO A . n A 1 116 ARG 116 125 125 ARG ARG A . n A 1 117 ALA 117 126 126 ALA ALA A . n A 1 118 GLY 118 127 127 GLY GLY A . n A 1 119 THR 119 128 128 THR THR A . n A 1 120 ILE 120 129 129 ILE ILE A . n A 1 121 LEU 121 130 130 LEU LEU A . n A 1 122 ALA 122 131 131 ALA ALA A . n A 1 123 ASN 123 132 132 ASN ASN A . n A 1 124 ASN 124 133 133 ASN ASN A . n A 1 125 SER 125 134 134 SER SER A . n A 1 126 PRO 126 135 135 PRO PRO A . n A 1 127 CYS 127 136 136 CYS CYS A . n A 1 128 TYR 128 137 137 TYR TYR A . n A 1 129 ILE 129 138 138 ILE ILE A . n A 1 130 THR 130 139 139 THR THR A . n A 1 131 GLY 131 140 140 GLY GLY A . n A 1 132 TRP 132 141 141 TRP TRP A . n A 1 133 GLY 133 142 142 GLY GLY A . n A 1 134 LEU 134 143 143 LEU LEU A . n A 1 135 THR 135 144 144 THR THR A . n A 1 136 ARG 136 145 145 ARG ARG A . n A 1 137 THR 137 147 147 THR THR A . n A 1 138 ASN 138 148 148 ASN ASN A . n A 1 139 GLY 139 149 149 GLY GLY A . n A 1 140 GLN 140 150 150 GLN GLN A . n A 1 141 LEU 141 151 151 LEU LEU A . n A 1 142 ALA 142 152 152 ALA ALA A . n A 1 143 GLN 143 153 153 GLN GLN A . n A 1 144 THR 144 154 154 THR THR A . n A 1 145 LEU 145 155 155 LEU LEU A . n A 1 146 GLN 146 156 156 GLN GLN A . n A 1 147 GLN 147 157 157 GLN GLN A . n A 1 148 ALA 148 158 158 ALA ALA A . n A 1 149 TYR 149 159 159 TYR TYR A . n A 1 150 LEU 150 160 160 LEU LEU A . n A 1 151 PRO 151 161 161 PRO PRO A . n A 1 152 THR 152 162 162 THR THR A . n A 1 153 VAL 153 163 163 VAL VAL A . n A 1 154 ASP 154 164 164 ASP ASP A . n A 1 155 TYR 155 165 165 TYR TYR A . n A 1 156 ALA 156 166 166 ALA ALA A . n A 1 157 ILE 157 167 167 ILE ILE A . n A 1 158 CYS 158 168 168 CYS CYS A . n A 1 159 SER 159 169 169 SER SER A . n A 1 160 SER 160 170 170 SER SER A . n A 1 161 SER 161 171 171 SER SER A A n A 1 162 SER 162 171 171 SER SER A B n A 1 163 TYR 163 171 171 TYR TYR A . n A 1 164 TRP 164 172 172 TRP TRP A . n A 1 165 GLY 165 173 173 GLY GLY A . n A 1 166 SER 166 174 174 SER SER A . n A 1 167 THR 167 175 175 THR THR A . n A 1 168 VAL 168 176 176 VAL VAL A . n A 1 169 LYS 169 177 177 LYS LYS A . n A 1 170 ASN 170 178 178 ASN ASN A . n A 1 171 SER 171 179 179 SER SER A . n A 1 172 MET 172 180 180 MET MET A . n A 1 173 VAL 173 181 181 VAL VAL A . n A 1 174 CYS 174 182 182 CYS CYS A . n A 1 175 ALA 175 183 183 ALA ALA A . n A 1 176 GLY 176 184 184 GLY GLY A . n A 1 177 GLY 177 185 185 GLY GLY A . n A 1 178 ASP 178 186 186 ASP ASP A . n A 1 179 GLY 179 187 187 GLY GLY A . n A 1 180 VAL 180 188 188 VAL VAL A . n A 1 181 ARG 181 188 188 ARG ARG A A n A 1 182 SER 182 189 189 SER SER A . n A 1 183 GLY 183 190 190 GLY GLY A . n A 1 184 CYS 184 191 191 CYS CYS A . n A 1 185 GLN 185 192 192 GLN GLN A . n A 1 186 GLY 186 193 193 GLY GLY A . n A 1 187 ASP 187 194 194 ASP ASP A . n A 1 188 SER 188 195 195 SER SER A . n A 1 189 GLY 189 196 196 GLY GLY A . n A 1 190 GLY 190 197 197 GLY GLY A . n A 1 191 PRO 191 198 198 PRO PRO A . n A 1 192 LEU 192 199 199 LEU LEU A . n A 1 193 HIS 193 200 200 HIS HIS A . n A 1 194 CYS 194 201 201 CYS CYS A . n A 1 195 LEU 195 202 202 LEU LEU A . n A 1 196 VAL 196 203 203 VAL VAL A . n A 1 197 ASN 197 204 204 ASN ASN A . n A 1 198 GLY 198 205 205 GLY GLY A . n A 1 199 GLN 199 206 206 GLN GLN A . n A 1 200 TYR 200 207 207 TYR TYR A . n A 1 201 ALA 201 208 208 ALA ALA A . n A 1 202 VAL 202 209 209 VAL VAL A . n A 1 203 HIS 203 210 210 HIS HIS A . n A 1 204 GLY 204 211 211 GLY GLY A . n A 1 205 VAL 205 212 212 VAL VAL A . n A 1 206 THR 206 213 213 THR THR A . n A 1 207 SER 207 214 214 SER SER A . n A 1 208 PHE 208 215 215 PHE PHE A . n A 1 209 VAL 209 216 216 VAL VAL A . n A 1 210 SER 210 217 217 SER SER A . n A 1 211 ARG 211 217 217 ARG ARG A A n A 1 212 LEU 212 218 218 LEU LEU A . n A 1 213 GLY 213 219 219 GLY GLY A . n A 1 214 CYS 214 220 220 CYS CYS A . n A 1 215 ASN 215 221 221 ASN ASN A . n A 1 216 VAL 216 221 221 VAL VAL A A n A 1 217 THR 217 222 222 THR THR A . n A 1 218 ARG 218 223 223 ARG ARG A . n A 1 219 LYS 219 224 224 LYS LYS A . n A 1 220 PRO 220 225 225 PRO PRO A . n A 1 221 THR 221 226 226 THR THR A . n A 1 222 VAL 222 227 227 VAL VAL A . n A 1 223 PHE 223 228 228 PHE PHE A . n A 1 224 THR 224 229 229 THR THR A . n A 1 225 ARG 225 230 230 ARG ARG A . n A 1 226 VAL 226 231 231 VAL VAL A . n A 1 227 SER 227 232 232 SER SER A . n A 1 228 ALA 228 233 233 ALA ALA A . n A 1 229 TYR 229 234 234 TYR TYR A . n A 1 230 ILE 230 235 235 ILE ILE A . n A 1 231 SER 231 236 236 SER SER A . n A 1 232 TRP 232 237 237 TRP TRP A . n A 1 233 ILE 233 238 238 ILE ILE A . n A 1 234 ASN 234 239 239 ASN ASN A . n A 1 235 ASN 235 240 240 ASN ASN A . n A 1 236 VAL 236 241 241 VAL VAL A . n A 1 237 ILE 237 242 242 ILE ILE A . n A 1 238 ALA 238 243 243 ALA ALA A . n A 1 239 SER 239 244 244 SER SER A . n A 1 240 ASN 240 245 245 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 246 246 SO4 SO4 A . C 3 TSU 1 247 247 TSU TSU A . D 4 HOH 1 248 248 HOH HOH A . D 4 HOH 2 249 249 HOH HOH A . D 4 HOH 3 250 250 HOH HOH A . D 4 HOH 4 251 251 HOH HOH A . D 4 HOH 5 252 252 HOH HOH A . D 4 HOH 6 253 253 HOH HOH A . D 4 HOH 7 254 254 HOH HOH A . D 4 HOH 8 255 255 HOH HOH A . D 4 HOH 9 256 256 HOH HOH A . D 4 HOH 10 257 257 HOH HOH A . D 4 HOH 11 258 258 HOH HOH A . D 4 HOH 12 259 259 HOH HOH A . D 4 HOH 13 260 260 HOH HOH A . D 4 HOH 14 261 261 HOH HOH A . D 4 HOH 15 262 262 HOH HOH A . D 4 HOH 16 263 263 HOH HOH A . D 4 HOH 17 264 264 HOH HOH A . D 4 HOH 18 265 265 HOH HOH A . D 4 HOH 19 266 266 HOH HOH A . D 4 HOH 20 267 267 HOH HOH A . D 4 HOH 21 268 268 HOH HOH A . D 4 HOH 22 269 269 HOH HOH A . D 4 HOH 23 270 270 HOH HOH A . D 4 HOH 24 271 271 HOH HOH A . D 4 HOH 25 272 272 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1976-05-27 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2011-08-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Non-polymer description' # _pdbx_database_remark.id 700 _pdbx_database_remark.text ;SHEET THE TWO SEVEN STRANDED SHEETS IN THIS STRUCTURE ARE REALLY SIX STRANDED BETA BARRELS - THIS IS DENOTED BY THE FIRST STRAND RECURRING AS THE LAST STRAND. ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OG A SER 195 ? ? S A TSU 247 ? ? 1.45 2 1 O A GLN 75 ? ? O A HOH 272 ? ? 1.92 3 1 OD1 A ASN 77 ? ? O A HOH 272 ? ? 2.07 4 1 O A ASN 72 ? ? O A HOH 272 ? ? 2.10 5 1 O A HOH 266 ? ? O A HOH 267 ? ? 2.18 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 NE1 A TRP 27 ? ? CE2 A TRP 27 ? ? 1.275 1.371 -0.096 0.013 N 2 1 NE1 A TRP 38 ? ? CE2 A TRP 38 ? ? 1.275 1.371 -0.096 0.013 N 3 1 NE1 A TRP 51 ? ? CE2 A TRP 51 ? ? 1.275 1.371 -0.096 0.013 N 4 1 NE1 A TRP 94 ? ? CE2 A TRP 94 ? ? 1.275 1.371 -0.096 0.013 N 5 1 NE1 A TRP 141 ? ? CE2 A TRP 141 ? ? 1.276 1.371 -0.095 0.013 N 6 1 NE1 A TRP 172 ? ? CE2 A TRP 172 ? ? 1.274 1.371 -0.097 0.013 N 7 1 NE1 A TRP 237 ? ? CE2 A TRP 237 ? ? 1.275 1.371 -0.096 0.013 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 24 ? ? -25.92 -47.16 2 1 GLU A 62 ? ? -59.54 79.88 3 1 HIS A 71 ? ? -139.06 -53.19 4 1 ASN A 76 ? ? -59.25 105.70 5 1 PRO A 92 ? ? -43.13 -18.69 6 1 THR A 96 ? ? -36.52 -39.57 7 1 TYR A 101 ? ? 48.03 24.49 8 1 ASN A 115 ? ? -139.22 -159.95 9 1 ASN A 133 ? ? 85.71 8.79 10 1 ASP A 164 ? ? -58.49 171.31 11 1 TYR A 171 ? ? -109.43 -112.76 12 1 GLN A 192 ? ? -42.07 107.73 13 1 SER A 195 ? ? -38.08 139.16 14 1 THR A 213 ? ? -38.46 107.51 15 1 SER A 214 ? ? -98.61 -70.91 16 1 LYS A 224 ? ? -118.26 72.81 17 1 ARG A 230 ? ? -59.39 86.08 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLY _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 197 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 PRO _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 198 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -147.45 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 GLU A 21 ? ? 11.54 2 1 GLN A 23 ? ? 14.85 3 1 LEU A 33 ? ? 12.94 4 1 ARG A 36 ? ? 12.22 5 1 SER A 36 A ? 12.84 6 1 HIS A 40 ? ? 11.42 7 1 CYS A 42 ? ? -11.23 8 1 LEU A 46 ? ? 10.16 9 1 GLN A 49 ? ? -10.69 10 1 THR A 54 ? ? 10.93 11 1 HIS A 57 ? ? -14.21 12 1 ARG A 61 ? ? 12.34 13 1 THR A 64 ? ? 10.42 14 1 ARG A 65 A ? 10.76 15 1 VAL A 66 ? ? 12.74 16 1 VAL A 68 ? ? 10.15 17 1 GLY A 69 ? ? 11.41 18 1 ASN A 72 ? ? 12.10 19 1 GLU A 80 ? ? 11.93 20 1 VAL A 90 ? ? 12.92 21 1 HIS A 91 ? ? 10.46 22 1 TRP A 94 ? ? 15.11 23 1 ASN A 95 ? ? 12.12 24 1 VAL A 99 ? ? -12.42 25 1 ALA A 99 A ? -10.44 26 1 GLY A 100 ? ? -10.13 27 1 ILE A 103 ? ? 11.90 28 1 ARG A 107 ? ? 13.15 29 1 THR A 113 ? ? 10.88 30 1 LEU A 114 ? ? 12.06 31 1 SER A 116 ? ? -10.09 32 1 VAL A 118 ? ? 11.27 33 1 GLY A 121 ? ? 11.63 34 1 VAL A 122 ? ? 11.85 35 1 ARG A 125 ? ? 12.80 36 1 ALA A 126 ? ? 11.24 37 1 ASN A 132 ? ? 12.19 38 1 ILE A 138 ? ? 13.39 39 1 TRP A 141 ? ? -10.08 40 1 THR A 147 ? ? 11.77 41 1 ALA A 152 ? ? 12.17 42 1 LEU A 155 ? ? 13.06 43 1 TYR A 159 ? ? 12.42 44 1 VAL A 163 ? ? 10.50 45 1 ASP A 164 ? ? -11.62 46 1 TYR A 165 ? ? -13.20 47 1 ALA A 166 ? ? -15.64 48 1 ILE A 167 ? ? -11.58 49 1 CYS A 168 ? ? -11.77 50 1 SER A 170 ? ? 11.55 51 1 TYR A 171 ? ? -13.39 52 1 THR A 175 ? ? -10.31 53 1 VAL A 176 ? ? 13.31 54 1 ASN A 178 ? ? -12.84 55 1 VAL A 181 ? ? 10.42 56 1 CYS A 182 ? ? 12.19 57 1 SER A 189 ? ? -13.14 58 1 CYS A 191 ? ? 11.90 59 1 GLY A 196 ? ? 11.36 60 1 GLY A 197 ? ? 10.79 61 1 PRO A 198 ? ? 12.21 62 1 LEU A 199 ? ? 11.21 63 1 ASN A 204 ? ? 10.61 64 1 SER A 217 ? ? 10.46 65 1 ASN A 221 ? ? 11.36 66 1 VAL A 221 A ? 12.09 67 1 THR A 222 ? ? 10.61 68 1 THR A 226 ? ? 13.40 69 1 VAL A 227 ? ? 10.21 70 1 THR A 229 ? ? 12.90 71 1 ILE A 235 ? ? -10.17 72 1 TRP A 237 ? ? -11.80 73 1 ILE A 238 ? ? -15.58 74 1 ASN A 239 ? ? -11.68 75 1 ASN A 240 ? ? -12.07 76 1 VAL A 241 ? ? -13.66 77 1 ILE A 242 ? ? -14.88 78 1 SER A 244 ? ? 12.16 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 35 ? ? 0.120 'SIDE CHAIN' 2 1 ASN A 77 ? ? 0.081 'SIDE CHAIN' 3 1 TYR A 82 ? ? 0.073 'SIDE CHAIN' 4 1 TYR A 93 ? ? 0.115 'SIDE CHAIN' 5 1 ASN A 115 ? ? 0.074 'SIDE CHAIN' 6 1 TYR A 117 ? ? 0.073 'SIDE CHAIN' 7 1 TYR A 171 ? ? 0.071 'SIDE CHAIN' 8 1 ASN A 245 ? ? 0.077 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 1 A SO4 246 ? O1 ? B SO4 1 O1 2 1 N 1 A SO4 246 ? O2 ? B SO4 1 O2 3 1 N 1 A SO4 246 ? O3 ? B SO4 1 O3 4 1 N 1 A SO4 246 ? O4 ? B SO4 1 O4 5 1 N 1 A TSU 247 ? O1 ? C TSU 1 O1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'PARA-TOLUENE SULFONATE' TSU 4 water HOH #