data_1EZT # _entry.id 1EZT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1EZT pdb_00001ezt 10.2210/pdb1ezt/pdb RCSB RCSB011069 ? ? WWPDB D_1000011069 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1EZY _pdbx_database_related.details '1EZY is the ensemble structure of free RGS4' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1EZT _pdbx_database_status.recvd_initial_deposition_date 2000-05-11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Moy, F.J.' 1 'Chanda, P.K.' 2 'Cockett, M.I.' 3 'Edris, W.' 4 'Jones, P.G.' 5 'Mason, K.' 6 'Semus, S.' 7 'Powers, R.' 8 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'NMR structure of free RGS4 reveals an induced conformational change upon binding Galpha.' Biochemistry 39 7063 7073 2000 BICHAW US 0006-2960 0033 ? 10852703 10.1021/bi992760w 1 '1H, 15N, 13C, and 13CO Assignments and Secondary Structure Determination of RGS4' J.Biomol.NMR 15 339 340 1999 JBNME9 NE 0925-2738 0800 ? ? 10.1023/A:1008343609739 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Moy, F.J.' 1 ? primary 'Chanda, P.K.' 2 ? primary 'Cockett, M.I.' 3 ? primary 'Edris, W.' 4 ? primary 'Jones, P.G.' 5 ? primary 'Mason, K.' 6 ? primary 'Semus, S.' 7 ? primary 'Powers, R.' 8 ? 1 'Moy, F.J.' 9 ? 1 'Chanda, P.K.' 10 ? 1 'Cockett, M.I.' 11 ? 1 'Edris, W.' 12 ? 1 'Jones, P.G.' 13 ? 1 'Powers, R.' 14 ? # _cell.entry_id 1EZT _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1EZT _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'REGULATOR OF G-PROTEIN SIGNALING 4' _entity.formula_weight 19145.711 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'CORE RGS DOMAIN' _entity.details 'SIX RESIDUE HISTIDINE TAG AT C-TERMINUS' # _entity_name_com.entity_id 1 _entity_name_com.name RGS4 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRGSVSQEEVKKWAESLENLINHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKE VNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLTNPSSCGAEKQKGAKSSADCTSLVPQCAH HHHHHP ; _entity_poly.pdbx_seq_one_letter_code_can ;MRGSVSQEEVKKWAESLENLINHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKE VNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLTNPSSCGAEKQKGAKSSADCTSLVPQCAH HHHHHP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 GLY n 1 4 SER n 1 5 VAL n 1 6 SER n 1 7 GLN n 1 8 GLU n 1 9 GLU n 1 10 VAL n 1 11 LYS n 1 12 LYS n 1 13 TRP n 1 14 ALA n 1 15 GLU n 1 16 SER n 1 17 LEU n 1 18 GLU n 1 19 ASN n 1 20 LEU n 1 21 ILE n 1 22 ASN n 1 23 HIS n 1 24 GLU n 1 25 CYS n 1 26 GLY n 1 27 LEU n 1 28 ALA n 1 29 ALA n 1 30 PHE n 1 31 LYS n 1 32 ALA n 1 33 PHE n 1 34 LEU n 1 35 LYS n 1 36 SER n 1 37 GLU n 1 38 TYR n 1 39 SER n 1 40 GLU n 1 41 GLU n 1 42 ASN n 1 43 ILE n 1 44 ASP n 1 45 PHE n 1 46 TRP n 1 47 ILE n 1 48 SER n 1 49 CYS n 1 50 GLU n 1 51 GLU n 1 52 TYR n 1 53 LYS n 1 54 LYS n 1 55 ILE n 1 56 LYS n 1 57 SER n 1 58 PRO n 1 59 SER n 1 60 LYS n 1 61 LEU n 1 62 SER n 1 63 PRO n 1 64 LYS n 1 65 ALA n 1 66 LYS n 1 67 LYS n 1 68 ILE n 1 69 TYR n 1 70 ASN n 1 71 GLU n 1 72 PHE n 1 73 ILE n 1 74 SER n 1 75 VAL n 1 76 GLN n 1 77 ALA n 1 78 THR n 1 79 LYS n 1 80 GLU n 1 81 VAL n 1 82 ASN n 1 83 LEU n 1 84 ASP n 1 85 SER n 1 86 CYS n 1 87 THR n 1 88 ARG n 1 89 GLU n 1 90 GLU n 1 91 THR n 1 92 SER n 1 93 ARG n 1 94 ASN n 1 95 MET n 1 96 LEU n 1 97 GLU n 1 98 PRO n 1 99 THR n 1 100 ILE n 1 101 THR n 1 102 CYS n 1 103 PHE n 1 104 ASP n 1 105 GLU n 1 106 ALA n 1 107 GLN n 1 108 LYS n 1 109 LYS n 1 110 ILE n 1 111 PHE n 1 112 ASN n 1 113 LEU n 1 114 MET n 1 115 GLU n 1 116 LYS n 1 117 ASP n 1 118 SER n 1 119 TYR n 1 120 ARG n 1 121 ARG n 1 122 PHE n 1 123 LEU n 1 124 LYS n 1 125 SER n 1 126 ARG n 1 127 PHE n 1 128 TYR n 1 129 LEU n 1 130 ASP n 1 131 LEU n 1 132 THR n 1 133 ASN n 1 134 PRO n 1 135 SER n 1 136 SER n 1 137 CYS n 1 138 GLY n 1 139 ALA n 1 140 GLU n 1 141 LYS n 1 142 GLN n 1 143 LYS n 1 144 GLY n 1 145 ALA n 1 146 LYS n 1 147 SER n 1 148 SER n 1 149 ALA n 1 150 ASP n 1 151 CYS n 1 152 THR n 1 153 SER n 1 154 LEU n 1 155 VAL n 1 156 PRO n 1 157 GLN n 1 158 CYS n 1 159 ALA n 1 160 HIS n 1 161 HIS n 1 162 HIS n 1 163 HIS n 1 164 HIS n 1 165 HIS n 1 166 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ BRAIN _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PRGS4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_code RGS4_RAT _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P49799 _struct_ref.pdbx_align_begin 51 _struct_ref.pdbx_seq_one_letter_code ;VSQEEVKKWAESLENLINHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLD SCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLTNPSSCGAEKQKGAKSSADCTSLVPQCA ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1EZT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 159 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P49799 _struct_ref_seq.db_align_beg 51 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 205 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 159 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1EZT MET A 1 ? UNP P49799 ? ? 'cloning artifact' 1 1 1 1EZT ARG A 2 ? UNP P49799 ? ? 'cloning artifact' 2 2 1 1EZT GLY A 3 ? UNP P49799 ? ? 'cloning artifact' 3 3 1 1EZT SER A 4 ? UNP P49799 ? ? 'cloning artifact' 4 4 1 1EZT HIS A 160 ? UNP P49799 ? ? 'expression tag' 160 5 1 1EZT HIS A 161 ? UNP P49799 ? ? 'expression tag' 161 6 1 1EZT HIS A 162 ? UNP P49799 ? ? 'expression tag' 162 7 1 1EZT HIS A 163 ? UNP P49799 ? ? 'expression tag' 163 8 1 1EZT HIS A 164 ? UNP P49799 ? ? 'expression tag' 164 9 1 1EZT HIS A 165 ? UNP P49799 ? ? 'expression tag' 165 10 1 1EZT PRO A 166 ? UNP P49799 ? ? 'cloning artifact' 166 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 2 1 3D_13C-separated_NOESY 2 3 1 3D_15N-separated_NOESY 3 3 1 HNHA # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50 mM K' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1 mM RGS4 U-15N,13C; 50mM phosphate buffer, 2 mM NaN3, 50 mM deuterated DTT, pH 6.0' '90% H2O/10% D2O' 2 '1 mM RGS4 U-15N,13C; 50mM phosphate buffer, 2 mM NaN3, 50 mM deuterated DTT, pH 6.0' '100% D2O' 3 '1 mM RGS4 U-15N; 50mM phosphate buffer, 2 mM NaN3, 50 mM deuterated DTT, pH 6.0' '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AMX _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1EZT _pdbx_nmr_refine.method 'distance geometry simulated annealing' _pdbx_nmr_refine.details ;The structure is based on a total of 2871 restraints, 1960 approximate interproton distance restraints, 78 distance restraints for 39 backbone hydrogen bonds, 431 torsion angle restraints, 132 3JHNa restraints, 136 Ca and 134 Cb chemical shift restraints. Structure also refined with conformational database target function. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1EZT _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 3.840 'structure solution' Brunger 1 NMRPipe 1.7 processing Delaglio 2 PIPP 4.2.8 'data analysis' Garrett 3 XwinNMR 2.0 collection Bruker 4 X-PLOR 3.840 refinement Brunger 5 # _exptl.entry_id 1EZT _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1EZT _struct.title 'HIGH-RESOLUTION SOLUTION STRUCTURE OF FREE RGS4 BY NMR' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1EZT _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN INHIBITOR' _struct_keywords.text '4-helix-bundle, free form of protein, SIGNALING PROTEIN INHIBITOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 6 ? SER A 16 ? SER A 6 SER A 16 1 ? 11 HELX_P HELX_P2 2 SER A 16 ? HIS A 23 ? SER A 16 HIS A 23 1 ? 8 HELX_P HELX_P3 3 HIS A 23 ? GLU A 37 ? HIS A 23 GLU A 37 1 ? 15 HELX_P HELX_P4 4 SER A 39 ? ILE A 55 ? SER A 39 ILE A 55 1 ? 17 HELX_P HELX_P5 5 SER A 57 ? ILE A 73 ? SER A 57 ILE A 73 1 ? 17 HELX_P HELX_P6 6 ASP A 84 ? MET A 95 ? ASP A 84 MET A 95 1 ? 12 HELX_P HELX_P7 7 PHE A 103 ? SER A 125 ? PHE A 103 SER A 125 1 ? 23 HELX_P HELX_P8 8 SER A 125 ? THR A 132 ? SER A 125 THR A 132 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1EZT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1EZT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ARG 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 TRP 13 13 13 TRP TRP A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 TRP 46 46 46 TRP TRP A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 CYS 86 86 86 CYS CYS A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 CYS 102 102 102 CYS CYS A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 MET 114 114 114 MET MET A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 PHE 122 122 122 PHE PHE A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 PRO 134 134 ? ? ? A . n A 1 135 SER 135 135 ? ? ? A . n A 1 136 SER 136 136 ? ? ? A . n A 1 137 CYS 137 137 ? ? ? A . n A 1 138 GLY 138 138 ? ? ? A . n A 1 139 ALA 139 139 ? ? ? A . n A 1 140 GLU 140 140 ? ? ? A . n A 1 141 LYS 141 141 ? ? ? A . n A 1 142 GLN 142 142 ? ? ? A . n A 1 143 LYS 143 143 ? ? ? A . n A 1 144 GLY 144 144 ? ? ? A . n A 1 145 ALA 145 145 ? ? ? A . n A 1 146 LYS 146 146 ? ? ? A . n A 1 147 SER 147 147 ? ? ? A . n A 1 148 SER 148 148 ? ? ? A . n A 1 149 ALA 149 149 ? ? ? A . n A 1 150 ASP 150 150 ? ? ? A . n A 1 151 CYS 151 151 ? ? ? A . n A 1 152 THR 152 152 ? ? ? A . n A 1 153 SER 153 153 ? ? ? A . n A 1 154 LEU 154 154 ? ? ? A . n A 1 155 VAL 155 155 ? ? ? A . n A 1 156 PRO 156 156 ? ? ? A . n A 1 157 GLN 157 157 ? ? ? A . n A 1 158 CYS 158 158 ? ? ? A . n A 1 159 ALA 159 159 ? ? ? A . n A 1 160 HIS 160 160 ? ? ? A . n A 1 161 HIS 161 161 ? ? ? A . n A 1 162 HIS 162 162 ? ? ? A . n A 1 163 HIS 163 163 ? ? ? A . n A 1 164 HIS 164 164 ? ? ? A . n A 1 165 HIS 165 165 ? ? ? A . n A 1 166 PRO 166 166 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-01-15 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD22 A ASN 42 ? ? HD22 A ASN 82 ? ? 1.24 2 1 HD1 A HIS 23 ? ? H A GLY 26 ? ? 1.35 3 1 O A TYR 128 ? ? HG1 A THR 132 ? ? 1.43 4 1 O A SER 118 ? ? H A PHE 122 ? ? 1.47 5 1 O A GLY 26 ? ? H A PHE 30 ? ? 1.48 6 1 O A ILE 68 ? ? H A PHE 72 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 16 ? ? -173.97 142.37 2 1 ASP A 117 ? ? -124.88 -57.88 3 1 THR A 132 ? ? -117.78 73.95 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ARG 2 ? A ARG 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A PRO 134 ? A PRO 134 6 1 Y 1 A SER 135 ? A SER 135 7 1 Y 1 A SER 136 ? A SER 136 8 1 Y 1 A CYS 137 ? A CYS 137 9 1 Y 1 A GLY 138 ? A GLY 138 10 1 Y 1 A ALA 139 ? A ALA 139 11 1 Y 1 A GLU 140 ? A GLU 140 12 1 Y 1 A LYS 141 ? A LYS 141 13 1 Y 1 A GLN 142 ? A GLN 142 14 1 Y 1 A LYS 143 ? A LYS 143 15 1 Y 1 A GLY 144 ? A GLY 144 16 1 Y 1 A ALA 145 ? A ALA 145 17 1 Y 1 A LYS 146 ? A LYS 146 18 1 Y 1 A SER 147 ? A SER 147 19 1 Y 1 A SER 148 ? A SER 148 20 1 Y 1 A ALA 149 ? A ALA 149 21 1 Y 1 A ASP 150 ? A ASP 150 22 1 Y 1 A CYS 151 ? A CYS 151 23 1 Y 1 A THR 152 ? A THR 152 24 1 Y 1 A SER 153 ? A SER 153 25 1 Y 1 A LEU 154 ? A LEU 154 26 1 Y 1 A VAL 155 ? A VAL 155 27 1 Y 1 A PRO 156 ? A PRO 156 28 1 Y 1 A GLN 157 ? A GLN 157 29 1 Y 1 A CYS 158 ? A CYS 158 30 1 Y 1 A ALA 159 ? A ALA 159 31 1 Y 1 A HIS 160 ? A HIS 160 32 1 Y 1 A HIS 161 ? A HIS 161 33 1 Y 1 A HIS 162 ? A HIS 162 34 1 Y 1 A HIS 163 ? A HIS 163 35 1 Y 1 A HIS 164 ? A HIS 164 36 1 Y 1 A HIS 165 ? A HIS 165 37 1 Y 1 A PRO 166 ? A PRO 166 #