data_1F1F # _entry.id 1F1F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.338 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1F1F RCSB RCSB011125 WWPDB D_1000011125 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1CYI _pdbx_database_related.details '1CYI contains crystal structure of cytochrome c6 from Chlamydomonas reinhardtii' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1F1F _pdbx_database_status.recvd_initial_deposition_date 2000-05-18 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kerfeld, C.A.' 1 'Serag, A.A.' 2 'Sawaya, M.R.' 3 'Krogmann, D.W.' 4 'Yeates, T.O.' 5 # _citation.id primary _citation.title 'Structures of cytochrome c-549 and cytochrome c6 from the cyanobacterium Arthrospira maxima.' _citation.journal_abbrev Biochemistry _citation.journal_volume 40 _citation.page_first 9215 _citation.page_last 9225 _citation.year 2001 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11478889 _citation.pdbx_database_id_DOI 10.1021/bi002679p # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sawaya, M.R.' 1 ? primary 'Krogmann, D.W.' 2 ? primary 'Serag, A.' 3 ? primary 'Ho, K.K.' 4 ? primary 'Yeates, T.O.' 5 ? primary 'Kerfeld, C.A.' 6 ? # _cell.entry_id 1F1F _cell.length_a 79.400 _cell.length_b 67.800 _cell.length_c 49.700 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1F1F _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'CYTOCHROME C6' 9230.350 1 ? ? ? ? 2 non-polymer syn 'HEME C' 618.503 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GDVAAGASVFSANCAACHMGGRNVIVANKTLSKSDLAKYLKGFDDDAVAAVAYQVTNGKNAMPGFNGRLSPLQIEDVAAY VVDQAEKGW ; _entity_poly.pdbx_seq_one_letter_code_can ;GDVAAGASVFSANCAACHMGGRNVIVANKTLSKSDLAKYLKGFDDDAVAAVAYQVTNGKNAMPGFNGRLSPLQIEDVAAY VVDQAEKGW ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASP n 1 3 VAL n 1 4 ALA n 1 5 ALA n 1 6 GLY n 1 7 ALA n 1 8 SER n 1 9 VAL n 1 10 PHE n 1 11 SER n 1 12 ALA n 1 13 ASN n 1 14 CYS n 1 15 ALA n 1 16 ALA n 1 17 CYS n 1 18 HIS n 1 19 MET n 1 20 GLY n 1 21 GLY n 1 22 ARG n 1 23 ASN n 1 24 VAL n 1 25 ILE n 1 26 VAL n 1 27 ALA n 1 28 ASN n 1 29 LYS n 1 30 THR n 1 31 LEU n 1 32 SER n 1 33 LYS n 1 34 SER n 1 35 ASP n 1 36 LEU n 1 37 ALA n 1 38 LYS n 1 39 TYR n 1 40 LEU n 1 41 LYS n 1 42 GLY n 1 43 PHE n 1 44 ASP n 1 45 ASP n 1 46 ASP n 1 47 ALA n 1 48 VAL n 1 49 ALA n 1 50 ALA n 1 51 VAL n 1 52 ALA n 1 53 TYR n 1 54 GLN n 1 55 VAL n 1 56 THR n 1 57 ASN n 1 58 GLY n 1 59 LYS n 1 60 ASN n 1 61 ALA n 1 62 MET n 1 63 PRO n 1 64 GLY n 1 65 PHE n 1 66 ASN n 1 67 GLY n 1 68 ARG n 1 69 LEU n 1 70 SER n 1 71 PRO n 1 72 LEU n 1 73 GLN n 1 74 ILE n 1 75 GLU n 1 76 ASP n 1 77 VAL n 1 78 ALA n 1 79 ALA n 1 80 TYR n 1 81 VAL n 1 82 VAL n 1 83 ASP n 1 84 GLN n 1 85 ALA n 1 86 GLU n 1 87 LYS n 1 88 GLY n 1 89 TRP n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Arthrospira maxima' _entity_src_nat.pdbx_ncbi_taxonomy_id 129910 _entity_src_nat.genus Arthrospira _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_code CYC6_SPIMA _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00118 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1F1F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00118 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 89 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 89 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1F1F _struct_ref_seq_dif.mon_id LEU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 72 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P00118 _struct_ref_seq_dif.db_mon_id LYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 72 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 72 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H34 Fe N4 O4' 618.503 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1F1F _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 7.8 _exptl_crystal_grow.temp 298.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details ;0.1 M Tris, pH 7.8, 2.4 M (NH4)2SO4, 0.5 M LiSO4, 1% Glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 298.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS' _diffrn_detector.pdbx_collection_date 1995-06-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_wavelength 1.54 _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1F1F _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 2.7 _reflns.number_obs 7504 _reflns.number_all 7504 _reflns.percent_possible_obs 80.8 _reflns.pdbx_Rmerge_I_obs 0.0860000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 9.2 _reflns.B_iso_Wilson_estimate 27.6 _reflns.pdbx_redundancy 3.2 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.75 _reflns_shell.d_res_low 3.00 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 74.0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy ? _reflns_shell.number_unique_all 1212 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1F1F _refine.ls_number_reflns_obs 7504 _refine.ls_number_reflns_all 7504 _refine.pdbx_ls_sigma_I 0.0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 50.0 _refine.ls_d_res_high 2.7 _refine.ls_percent_reflns_obs 80.4 _refine.ls_R_factor_obs 0.2330000 _refine.ls_R_factor_all 0.2330000 _refine.ls_R_factor_R_work 0.2320000 _refine.ls_R_factor_R_free 0.2550000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 344 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details '5% Random' _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 643 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 43 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 686 _refine_hist.d_res_high 2.7 _refine_hist.d_res_low 50.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.011486 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.21714 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1F1F _struct.title 'CRYSTAL STRUCTURE OF CYTOCHROME C6 FROM ARTHROSPIRA MAXIMA' _struct.pdbx_descriptor 'CYTOCHROME C6 FROM ARTHROSPIRA MAXIMA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1F1F _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'cytochrome c6, heme, protein structure, cyanobacteria, photosynthesis, ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 2 ? CYS A 14 ? ASP A 2 CYS A 14 1 ? 13 HELX_P HELX_P2 2 CYS A 14 ? MET A 19 ? CYS A 14 MET A 19 1 ? 6 HELX_P HELX_P3 3 GLY A 20 ? ARG A 22 ? GLY A 20 ARG A 22 5 ? 3 HELX_P HELX_P4 4 SER A 32 ? LEU A 40 ? SER A 32 LEU A 40 1 ? 9 HELX_P HELX_P5 5 ASP A 46 ? GLY A 58 ? ASP A 46 GLY A 58 1 ? 13 HELX_P HELX_P6 6 SER A 70 ? GLY A 88 ? SER A 70 GLY A 88 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 14 SG ? ? ? 1_555 B HEC . CAB ? ? A CYS 14 A HEC 200 1_555 ? ? ? ? ? ? ? 1.828 ? ? covale2 covale none ? A CYS 17 SG ? ? ? 1_555 B HEC . CAC ? ? A CYS 17 A HEC 200 1_555 ? ? ? ? ? ? ? 1.830 ? ? metalc1 metalc ? ? A HIS 18 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 18 A HEC 200 1_555 ? ? ? ? ? ? ? 2.017 ? ? metalc2 metalc ? ? A MET 62 SD ? ? ? 1_555 B HEC . FE ? ? A MET 62 A HEC 200 1_555 ? ? ? ? ? ? ? 2.330 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id HEC _struct_site.pdbx_auth_seq_id 200 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 18 _struct_site.details 'BINDING SITE FOR RESIDUE HEC A 200' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 18 ASN A 13 ? ASN A 13 . ? 1_555 ? 2 AC1 18 CYS A 14 ? CYS A 14 . ? 1_555 ? 3 AC1 18 CYS A 17 ? CYS A 17 . ? 1_555 ? 4 AC1 18 HIS A 18 ? HIS A 18 . ? 1_555 ? 5 AC1 18 ASN A 23 ? ASN A 23 . ? 1_555 ? 6 AC1 18 LYS A 29 ? LYS A 29 . ? 1_555 ? 7 AC1 18 THR A 30 ? THR A 30 . ? 1_555 ? 8 AC1 18 LEU A 31 ? LEU A 31 . ? 1_555 ? 9 AC1 18 ASP A 35 ? ASP A 35 . ? 1_555 ? 10 AC1 18 LEU A 36 ? LEU A 36 . ? 1_555 ? 11 AC1 18 TYR A 39 ? TYR A 39 . ? 1_555 ? 12 AC1 18 GLN A 54 ? GLN A 54 . ? 1_555 ? 13 AC1 18 VAL A 55 ? VAL A 55 . ? 1_555 ? 14 AC1 18 LYS A 59 ? LYS A 59 . ? 1_555 ? 15 AC1 18 ASN A 60 ? ASN A 60 . ? 1_555 ? 16 AC1 18 ALA A 61 ? ALA A 61 . ? 1_555 ? 17 AC1 18 MET A 62 ? MET A 62 . ? 1_555 ? 18 AC1 18 GLU A 86 ? GLU A 86 . ? 2_554 ? # _database_PDB_matrix.entry_id 1F1F _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1F1F _atom_sites.fract_transf_matrix[1][1] 0.012594 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014749 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020121 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 TRP 89 89 89 TRP TRP A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HEC _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 200 _pdbx_nonpoly_scheme.auth_seq_num 200 _pdbx_nonpoly_scheme.pdb_mon_id HEC _pdbx_nonpoly_scheme.auth_mon_id HEM _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 18 ? A HIS 18 ? 1_555 FE ? B HEC . ? A HEC 200 ? 1_555 NA ? B HEC . ? A HEC 200 ? 1_555 92.4 ? 2 NE2 ? A HIS 18 ? A HIS 18 ? 1_555 FE ? B HEC . ? A HEC 200 ? 1_555 NB ? B HEC . ? A HEC 200 ? 1_555 91.1 ? 3 NA ? B HEC . ? A HEC 200 ? 1_555 FE ? B HEC . ? A HEC 200 ? 1_555 NB ? B HEC . ? A HEC 200 ? 1_555 91.7 ? 4 NE2 ? A HIS 18 ? A HIS 18 ? 1_555 FE ? B HEC . ? A HEC 200 ? 1_555 NC ? B HEC . ? A HEC 200 ? 1_555 86.9 ? 5 NA ? B HEC . ? A HEC 200 ? 1_555 FE ? B HEC . ? A HEC 200 ? 1_555 NC ? B HEC . ? A HEC 200 ? 1_555 179.3 ? 6 NB ? B HEC . ? A HEC 200 ? 1_555 FE ? B HEC . ? A HEC 200 ? 1_555 NC ? B HEC . ? A HEC 200 ? 1_555 88.6 ? 7 NE2 ? A HIS 18 ? A HIS 18 ? 1_555 FE ? B HEC . ? A HEC 200 ? 1_555 ND ? B HEC . ? A HEC 200 ? 1_555 85.9 ? 8 NA ? B HEC . ? A HEC 200 ? 1_555 FE ? B HEC . ? A HEC 200 ? 1_555 ND ? B HEC . ? A HEC 200 ? 1_555 90.2 ? 9 NB ? B HEC . ? A HEC 200 ? 1_555 FE ? B HEC . ? A HEC 200 ? 1_555 ND ? B HEC . ? A HEC 200 ? 1_555 176.4 ? 10 NC ? B HEC . ? A HEC 200 ? 1_555 FE ? B HEC . ? A HEC 200 ? 1_555 ND ? B HEC . ? A HEC 200 ? 1_555 89.4 ? 11 NE2 ? A HIS 18 ? A HIS 18 ? 1_555 FE ? B HEC . ? A HEC 200 ? 1_555 SD ? A MET 62 ? A MET 62 ? 1_555 170.5 ? 12 NA ? B HEC . ? A HEC 200 ? 1_555 FE ? B HEC . ? A HEC 200 ? 1_555 SD ? A MET 62 ? A MET 62 ? 1_555 95.4 ? 13 NB ? B HEC . ? A HEC 200 ? 1_555 FE ? B HEC . ? A HEC 200 ? 1_555 SD ? A MET 62 ? A MET 62 ? 1_555 94.1 ? 14 NC ? B HEC . ? A HEC 200 ? 1_555 FE ? B HEC . ? A HEC 200 ? 1_555 SD ? A MET 62 ? A MET 62 ? 1_555 85.3 ? 15 ND ? B HEC . ? A HEC 200 ? 1_555 FE ? B HEC . ? A HEC 200 ? 1_555 SD ? A MET 62 ? A MET 62 ? 1_555 88.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-08-08 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-04 5 'Structure model' 2 0 2021-03-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Refinement description' 4 5 'Structure model' 'Atomic model' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Derived calculations' 8 5 'Structure model' 'Non-polymer description' 9 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' atom_site 3 5 'Structure model' chem_comp 4 5 'Structure model' entity 5 5 'Structure model' pdbx_entity_nonpoly 6 5 'Structure model' pdbx_nonpoly_scheme 7 5 'Structure model' pdbx_struct_conn_angle 8 5 'Structure model' struct_conn 9 5 'Structure model' struct_conn_type 10 5 'Structure model' struct_ref_seq_dif 11 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_atom_site.B_iso_or_equiv' 2 5 'Structure model' '_atom_site.Cartn_x' 3 5 'Structure model' '_atom_site.Cartn_y' 4 5 'Structure model' '_atom_site.Cartn_z' 5 5 'Structure model' '_atom_site.auth_atom_id' 6 5 'Structure model' '_atom_site.auth_comp_id' 7 5 'Structure model' '_atom_site.label_atom_id' 8 5 'Structure model' '_atom_site.label_comp_id' 9 5 'Structure model' '_atom_site.type_symbol' 10 5 'Structure model' '_chem_comp.formula' 11 5 'Structure model' '_chem_comp.formula_weight' 12 5 'Structure model' '_chem_comp.id' 13 5 'Structure model' '_chem_comp.name' 14 5 'Structure model' '_chem_comp.pdbx_synonyms' 15 5 'Structure model' '_entity.formula_weight' 16 5 'Structure model' '_entity.pdbx_description' 17 5 'Structure model' '_pdbx_entity_nonpoly.comp_id' 18 5 'Structure model' '_pdbx_entity_nonpoly.name' 19 5 'Structure model' '_pdbx_nonpoly_scheme.mon_id' 20 5 'Structure model' '_pdbx_nonpoly_scheme.pdb_mon_id' 21 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 22 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 23 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 24 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 25 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 26 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 27 5 'Structure model' '_struct_conn.conn_type_id' 28 5 'Structure model' '_struct_conn.id' 29 5 'Structure model' '_struct_conn.pdbx_dist_value' 30 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 31 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 32 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 33 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 34 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 35 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 36 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 37 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 38 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 39 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 40 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 41 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 42 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 43 5 'Structure model' '_struct_conn_type.id' 44 5 'Structure model' '_struct_ref_seq_dif.details' 45 5 'Structure model' '_struct_site.details' 46 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 47 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 48 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal AMoRE phasing . ? 1 CNS refinement . ? 2 SCALEPACK 'data scaling' . ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 22 ? ? -105.45 -158.74 2 1 LYS A 29 ? ? -114.68 52.33 3 1 ASN A 60 ? ? 46.30 -123.24 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id GLY _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id GLY _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'HEME C' _pdbx_entity_nonpoly.comp_id HEC #