data_1F53 # _entry.id 1F53 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1F53 pdb_00001f53 10.2210/pdb1f53/pdb RCSB RCSB011253 ? ? WWPDB D_1000011253 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2BB2 '2BB2 contains BETA-B2-CRYSTALLIN' unspecified PDB 1AG4 '1AG4 contains SPHERULIN 3A' unspecified PDB 1PRS '1PRS contains DEVELOPMENT-SPECIFIC PROTEIN S (SPORE COAT PROTEIN S)' unspecified PDB 1WKT '1WKT contains YEAST KILLER TOXIN' unspecified PDB 1BHU '1BHU contains METALLOPROTEINASE INHIBITOR' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1F53 _pdbx_database_status.recvd_initial_deposition_date 2000-06-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ohki, S.' 1 'Kariya, E.' 2 'Hiraga, K.' 3 'Wakamiya, A.' 4 'Isobe, T.' 5 'Oda, K.' 6 'Kainosho, M.' 7 # _citation.id primary _citation.title ;NMR structure of Streptomyces killer toxin-like protein, SKLP: further evidence for the wide distribution of single-domain betagamma-crystallin superfamily proteins. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 305 _citation.page_first 109 _citation.page_last 120 _citation.year 2001 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11114251 _citation.pdbx_database_id_DOI 10.1006/jmbi.2000.4244 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ohki, S.Y.' 1 ? primary 'Kariya, E.' 2 ? primary 'Hiraga, K.' 3 ? primary 'Wakamiya, A.' 4 ? primary 'Isobe, T.' 5 ? primary 'Oda, K.' 6 ? primary 'Kainosho, M.' 7 ? # _cell.entry_id 1F53 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1F53 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'YEAST KILLER TOXIN-LIKE PROTEIN' _entity.formula_weight 9618.595 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IDHVPCRGGENFLKIWSHSGGQQSVDCYANRGRIDFGGWWVDKISTGNNDLIYYDANGDSVRVDRWHDITYPNRPPKVNS IEIL ; _entity_poly.pdbx_seq_one_letter_code_can ;IDHVPCRGGENFLKIWSHSGGQQSVDCYANRGRIDFGGWWVDKISTGNNDLIYYDANGDSVRVDRWHDITYPNRPPKVNS IEIL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 ASP n 1 3 HIS n 1 4 VAL n 1 5 PRO n 1 6 CYS n 1 7 ARG n 1 8 GLY n 1 9 GLY n 1 10 GLU n 1 11 ASN n 1 12 PHE n 1 13 LEU n 1 14 LYS n 1 15 ILE n 1 16 TRP n 1 17 SER n 1 18 HIS n 1 19 SER n 1 20 GLY n 1 21 GLY n 1 22 GLN n 1 23 GLN n 1 24 SER n 1 25 VAL n 1 26 ASP n 1 27 CYS n 1 28 TYR n 1 29 ALA n 1 30 ASN n 1 31 ARG n 1 32 GLY n 1 33 ARG n 1 34 ILE n 1 35 ASP n 1 36 PHE n 1 37 GLY n 1 38 GLY n 1 39 TRP n 1 40 TRP n 1 41 VAL n 1 42 ASP n 1 43 LYS n 1 44 ILE n 1 45 SER n 1 46 THR n 1 47 GLY n 1 48 ASN n 1 49 ASN n 1 50 ASP n 1 51 LEU n 1 52 ILE n 1 53 TYR n 1 54 TYR n 1 55 ASP n 1 56 ALA n 1 57 ASN n 1 58 GLY n 1 59 ASP n 1 60 SER n 1 61 VAL n 1 62 ARG n 1 63 VAL n 1 64 ASP n 1 65 ARG n 1 66 TRP n 1 67 HIS n 1 68 ASP n 1 69 ILE n 1 70 THR n 1 71 TYR n 1 72 PRO n 1 73 ASN n 1 74 ARG n 1 75 PRO n 1 76 PRO n 1 77 LYS n 1 78 VAL n 1 79 ASN n 1 80 SER n 1 81 ILE n 1 82 GLU n 1 83 ILE n 1 84 LEU n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Streptomyces sp.' _entity_src_nat.pdbx_ncbi_taxonomy_id 1931 _entity_src_nat.genus Streptomyces _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell F-287 _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name PDB _struct_ref.db_code 1F53 _struct_ref.pdbx_db_accession 1F53 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1F53 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 84 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 1F53 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 84 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 84 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 2 1 3D_15N-separated_NOESY 2 4 1 3D_13C-separated_NOESY 3 3 1 '2D NOESY' 4 2 1 HMQC-J # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '~1mM U-13C,15N SKLP' '90% H2O, 10% D2O, 100mM KCl pH6.0' 2 '~1mM U-15N SKLP' '90% H2O, 10% D2O, 100mM KCl pH6.0' 3 '~1mM unlabeled SKLP' '100% D2O, 100mM KCl pH6.0' 4 '~1mM U-13C,15N SKLP' '100% D2O, 100mM KCl pH6.0' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 500 2 ? Bruker DRX 600 3 ? Bruker AVANCE 800 # _pdbx_nmr_refine.entry_id 1F53 _pdbx_nmr_refine.method 'distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1F53 _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe ? processing ? 1 X-PLOR ? 'structure solution' ? 2 X-PLOR ? refinement ? 3 # _exptl.entry_id 1F53 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1F53 _struct.title 'NMR STRUCTURE OF KILLER TOXIN-LIKE PROTEIN SKLP' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1F53 _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'killer toxin-like protein, SKLP, crystallin family, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 6 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 27 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 6 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 27 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.476 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details S1 ? 5 ? S2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? parallel S1 2 3 ? anti-parallel S1 3 4 ? anti-parallel S1 4 5 ? anti-parallel S2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 ASP A 2 ? HIS A 3 ? ASP A 2 HIS A 3 S1 2 GLN A 23 ? ALA A 29 ? GLN A 23 ALA A 29 S1 3 LEU A 13 ? HIS A 18 ? LEU A 13 HIS A 18 S1 4 LYS A 43 ? THR A 46 ? LYS A 43 THR A 46 S1 5 HIS A 67 ? ILE A 69 ? HIS A 67 ILE A 69 S2 1 SER A 80 ? ILE A 83 ? SER A 80 ILE A 83 S2 2 ASP A 59 ? ASP A 64 ? ASP A 59 ASP A 64 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 N ASP A 2 ? N ASP A 2 O ALA A 29 ? O ALA A 29 S1 2 3 N TYR A 28 ? N TYR A 28 O LEU A 13 ? O LEU A 13 S1 3 4 N TRP A 16 ? N TRP A 16 O LYS A 43 ? O LYS A 43 S1 4 5 O ILE A 44 ? O ILE A 44 N ILE A 69 ? N ILE A 69 S2 1 2 O LEU A 51 ? O LEU A 51 N VAL A 63 ? N VAL A 63 # _database_PDB_matrix.entry_id 1F53 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1F53 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 1 1 ILE ILE A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 TRP 66 66 66 TRP TRP A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 LEU 84 84 84 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-12-27 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_spectrometer 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_sheet # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_struct_sheet.number_strands' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LYS 14 ? ? H A SER 45 ? ? 1.43 2 1 H A TRP 16 ? ? O A LYS 43 ? ? 1.45 3 1 O A LEU 51 ? ? H A VAL 63 ? ? 1.51 4 1 O A ASP 55 ? ? H A GLY 58 ? ? 1.55 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 6 ? ? 57.51 160.50 2 1 ARG A 7 ? ? -94.24 57.71 3 1 GLU A 10 ? ? -161.15 41.50 4 1 ASN A 11 ? ? 171.14 -153.26 5 1 PHE A 12 ? ? 44.48 -170.32 6 1 SER A 19 ? ? 177.26 166.85 7 1 SER A 24 ? ? -171.65 129.97 8 1 TYR A 28 ? ? -122.09 -164.08 9 1 ASN A 30 ? ? 65.04 -162.65 10 1 TRP A 39 ? ? 173.57 81.85 11 1 TRP A 40 ? ? -161.43 69.99 12 1 ASP A 42 ? ? 176.66 -0.92 13 1 LYS A 43 ? ? 156.32 161.99 14 1 SER A 45 ? ? -119.10 76.69 15 1 ASN A 48 ? ? 166.02 4.80 16 1 TYR A 54 ? ? -62.63 98.56 17 1 ALA A 56 ? ? -35.84 -30.63 18 1 SER A 60 ? ? -48.02 83.26 19 1 ASP A 64 ? ? -101.34 76.01 20 1 ARG A 65 ? ? 42.05 177.75 21 1 TRP A 66 ? ? 31.81 58.42 22 1 TYR A 71 ? ? -146.49 46.72 23 1 ASN A 73 ? ? -144.39 -50.79 24 1 ARG A 74 ? ? -53.83 -176.28 25 1 LYS A 77 ? ? 175.93 60.27 26 1 SER A 80 ? ? 173.03 170.46 27 1 GLU A 82 ? ? -175.76 75.87 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 7 ? ? 0.261 'SIDE CHAIN' 2 1 ARG A 31 ? ? 0.177 'SIDE CHAIN' 3 1 ARG A 33 ? ? 0.261 'SIDE CHAIN' 4 1 ARG A 62 ? ? 0.193 'SIDE CHAIN' 5 1 ARG A 65 ? ? 0.296 'SIDE CHAIN' 6 1 ARG A 74 ? ? 0.223 'SIDE CHAIN' #