data_1F70 # _entry.id 1F70 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1F70 pdb_00001f70 10.2210/pdb1f70/pdb RCSB RCSB011321 ? ? WWPDB D_1000011321 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1CFC 'NMR structure of full-length Calmodulin without dipolar coupling refinement' unspecified PDB 1DMO 'NMR structure of full-length Calmodulin without dipolar coupling refinement' unspecified PDB 1F71 'C-terminal domain of Calmodulin refined with dipolar couplings' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1F70 _pdbx_database_status.recvd_initial_deposition_date 2000-06-24 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chou, J.' 1 'Li, S.' 2 'Bax, A.' 3 # _citation.id primary _citation.title 'Study of conformational rearrangement and refinement of structural homology models by the use of heteronuclear dipolar couplings.' _citation.journal_abbrev J.Biomol.NMR _citation.journal_volume 18 _citation.page_first 217 _citation.page_last 227 _citation.year 2000 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11142512 _citation.pdbx_database_id_DOI 10.1023/A:1026563923774 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chou, J.J.' 1 ? primary 'Li, S.' 2 ? primary 'Bax, A.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description CALMODULIN _entity.formula_weight 8454.353 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-TERMINAL DOMAIN' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKM _entity_poly.pdbx_seq_one_letter_code_can ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKM _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 GLN n 1 4 LEU n 1 5 THR n 1 6 GLU n 1 7 GLU n 1 8 GLN n 1 9 ILE n 1 10 ALA n 1 11 GLU n 1 12 PHE n 1 13 LYS n 1 14 GLU n 1 15 ALA n 1 16 PHE n 1 17 SER n 1 18 LEU n 1 19 PHE n 1 20 ASP n 1 21 LYS n 1 22 ASP n 1 23 GLY n 1 24 ASP n 1 25 GLY n 1 26 THR n 1 27 ILE n 1 28 THR n 1 29 THR n 1 30 LYS n 1 31 GLU n 1 32 LEU n 1 33 GLY n 1 34 THR n 1 35 VAL n 1 36 MET n 1 37 ARG n 1 38 SER n 1 39 LEU n 1 40 GLY n 1 41 GLN n 1 42 ASN n 1 43 PRO n 1 44 THR n 1 45 GLU n 1 46 ALA n 1 47 GLU n 1 48 LEU n 1 49 GLN n 1 50 ASP n 1 51 MET n 1 52 ILE n 1 53 ASN n 1 54 GLU n 1 55 VAL n 1 56 ASP n 1 57 ALA n 1 58 ASP n 1 59 GLY n 1 60 ASN n 1 61 GLY n 1 62 THR n 1 63 ILE n 1 64 ASP n 1 65 PHE n 1 66 PRO n 1 67 GLU n 1 68 PHE n 1 69 LEU n 1 70 THR n 1 71 MET n 1 72 MET n 1 73 ALA n 1 74 ARG n 1 75 LYS n 1 76 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'African clawed frog' _entity_src_gen.gene_src_genus Xenopus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Xenopus laevis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 8355 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PTNCO12 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_code CALM_XENLA _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P62155 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1F70 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 76 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P62155 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 76 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 76 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D IPAP-HSQC (no H1 decoupling)' 2 2 1 '2D IPAP-HSQC (no H1 decoupling)' 3 1 1 '3D CT-(H)CA(CO)NH (no H1 decoupling)' 4 2 1 '3D CT-(H)CA(CO)NH (no H1 decoupling)' 5 1 1 '3D HNCO (no CA decoupling)' 6 2 1 '3D HNCO (no CA decoupling)' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM KCL' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1 mM Calmodulin U-15N,13C; 5 mM Hepe buffer, 100 mM KCL' '90% H2O/10% D2O' 2 '1 mM Calmodulin U-15N,13C; 5 mM Hepe buffer, 100 mM KCL; 21 mg/ml filamentous phage Pf1' '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 800 2 ? Bruker DMX 600 3 ? Bruker DMX 500 # _pdbx_nmr_refine.entry_id 1F70 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1F70 _pdbx_nmr_details.text 'This structure was refined using previous NMR restraints and newly measured dipolar couplings' # _pdbx_nmr_ensemble.entry_id 1F70 _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1F70 _pdbx_nmr_representative.conformer_id 10 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 NMRPipe 1.8 processing Delaglio 2 NMRDraw 1.8 'data analysis' Delaglio 3 X-PLOR 3.84 refinement Brunger 4 # _exptl.entry_id 1F70 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1F70 _struct.title 'REFINED SOLUTION STRUCTURE OF CALMODULIN N-TERMINAL DOMAIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1F70 _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' _struct_keywords.text 'Calcium binding, EF hands, four-helix bundle, TRANSPORT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 5 ? PHE A 19 ? THR A 5 PHE A 19 1 ? 15 HELX_P HELX_P2 2 GLU A 31 ? GLY A 40 ? GLU A 31 GLY A 40 1 ? 10 HELX_P HELX_P3 3 THR A 44 ? ASP A 56 ? THR A 44 ASP A 56 1 ? 13 HELX_P HELX_P4 4 PHE A 65 ? MET A 76 ? PHE A 65 MET A 76 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 26 ? THR A 28 ? THR A 26 THR A 28 A 2 THR A 62 ? ASP A 64 ? THR A 62 ASP A 64 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 27 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 27 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 63 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 63 # _database_PDB_matrix.entry_id 1F70 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1F70 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 MET 76 76 76 MET MET A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-09-22 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 56 ? ? H A GLY 61 ? ? 1.55 2 1 OD2 A ASP 20 ? ? H A GLY 25 ? ? 1.59 3 2 OD2 A ASP 56 ? ? H A GLY 61 ? ? 1.59 4 3 OD2 A ASP 56 ? ? H A GLY 61 ? ? 1.55 5 3 OD2 A ASP 20 ? ? H A GLY 25 ? ? 1.59 6 5 OD2 A ASP 56 ? ? H A GLY 61 ? ? 1.52 7 5 OD2 A ASP 20 ? ? H A GLY 25 ? ? 1.57 8 6 OD2 A ASP 56 ? ? H A GLY 61 ? ? 1.52 9 6 OD2 A ASP 20 ? ? H A GLY 25 ? ? 1.57 10 7 OD2 A ASP 56 ? ? H A GLY 61 ? ? 1.57 11 8 OD2 A ASP 56 ? ? H A GLY 61 ? ? 1.53 12 8 OD2 A ASP 20 ? ? H A GLY 25 ? ? 1.57 13 9 OD2 A ASP 56 ? ? H A GLY 61 ? ? 1.55 14 9 OD2 A ASP 20 ? ? H A GLY 25 ? ? 1.58 15 10 OD2 A ASP 56 ? ? H A GLY 61 ? ? 1.54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -58.51 83.10 2 2 ASP A 2 ? ? -173.54 83.97 3 3 ASP A 2 ? ? -58.51 83.10 4 4 ASP A 2 ? ? -58.64 83.67 5 5 ASP A 2 ? ? -169.67 83.81 6 6 ASP A 2 ? ? -169.67 83.81 7 8 ASP A 2 ? ? -58.51 83.11 8 10 ASP A 2 ? ? -58.43 83.46 #