data_1F95 # _entry.id 1F95 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1F95 RCSB RCSB011396 WWPDB D_1000011396 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1F3C _pdbx_database_related.details 'This is a solution structure of dynein light chain 8 (DLC8) complexed with one target, Bim.' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1F95 _pdbx_database_status.recvd_initial_deposition_date 2000-07-07 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Fan, J.-S.' 1 'Zhang, Q.' 2 'Tochio, H.' 3 'Li, M.' 4 'Zhang, M.' 5 # _citation.id primary _citation.title 'Structural basis of diverse sequence-dependent target recognition by the 8 kDa dynein light chain.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 306 _citation.page_first 97 _citation.page_last 108 _citation.year 2001 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11178896 _citation.pdbx_database_id_DOI 10.1006/jmbi.2000.4374 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Fan, J.' 1 primary 'Zhang, Q.' 2 primary 'Tochio, H.' 3 primary 'Li, M.' 4 primary 'Zhang, M.' 5 # _cell.entry_id 1F95 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1F95 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man DYNEIN 10381.899 2 ? ? '8KDA LIGHT CHAIN' ? 2 polymer syn 'BCL2-LIKE 11 (APOPTOSIS FACILITATOR)' 1001.114 2 ? ? 'DLC8 BINDING REGION' ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PROTEIN INHIBITOR OF NEURONAL NITRIC OXIDE SYNTHASE, DLC8' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQ VAILLFKSG ; ;MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQ VAILLFKSG ; A,B ? 2 'polypeptide(L)' no no MSCDKSTQT MSCDKSTQT C,D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 CYS n 1 3 ASP n 1 4 ARG n 1 5 LYS n 1 6 ALA n 1 7 VAL n 1 8 ILE n 1 9 LYS n 1 10 ASN n 1 11 ALA n 1 12 ASP n 1 13 MET n 1 14 SER n 1 15 GLU n 1 16 GLU n 1 17 MET n 1 18 GLN n 1 19 GLN n 1 20 ASP n 1 21 SER n 1 22 VAL n 1 23 GLU n 1 24 CYS n 1 25 ALA n 1 26 THR n 1 27 GLN n 1 28 ALA n 1 29 LEU n 1 30 GLU n 1 31 LYS n 1 32 TYR n 1 33 ASN n 1 34 ILE n 1 35 GLU n 1 36 LYS n 1 37 ASP n 1 38 ILE n 1 39 ALA n 1 40 ALA n 1 41 HIS n 1 42 ILE n 1 43 LYS n 1 44 LYS n 1 45 GLU n 1 46 PHE n 1 47 ASP n 1 48 LYS n 1 49 LYS n 1 50 TYR n 1 51 ASN n 1 52 PRO n 1 53 THR n 1 54 TRP n 1 55 HIS n 1 56 CYS n 1 57 ILE n 1 58 VAL n 1 59 GLY n 1 60 ARG n 1 61 ASN n 1 62 PHE n 1 63 GLY n 1 64 SER n 1 65 TYR n 1 66 VAL n 1 67 THR n 1 68 HIS n 1 69 GLU n 1 70 THR n 1 71 LYS n 1 72 HIS n 1 73 PHE n 1 74 ILE n 1 75 TYR n 1 76 PHE n 1 77 TYR n 1 78 LEU n 1 79 GLY n 1 80 GLN n 1 81 VAL n 1 82 ALA n 1 83 ILE n 1 84 LEU n 1 85 LEU n 1 86 PHE n 1 87 LYS n 1 88 SER n 1 89 GLY n 2 1 MET n 2 2 SER n 2 3 CYS n 2 4 ASP n 2 5 LYS n 2 6 SER n 2 7 THR n 2 8 GLN n 2 9 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET14B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'This peptide was chemically synthesized. This sequence occurs naturally in humans (Homo sapiens)' # loop_ _struct_ref.id _struct_ref.db_code _struct_ref.db_name _struct_ref.entity_id _struct_ref.pdbx_db_accession _struct_ref.pdbx_align_begin _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_db_isoform 1 DYL1_RAT UNP 1 P63170 1 ;MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQ VAILLFKSG ; ? 2 B2L11_HUMAN UNP 2 O43521 108 MSCDKSTQT ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1F95 A 1 ? 89 ? P63170 1 ? 89 ? 1 89 2 1 1F95 B 1 ? 89 ? P63170 1 ? 89 ? 1 89 3 2 1F95 C 1 ? 9 ? O43521 108 ? 116 ? 1 9 4 2 1F95 D 1 ? 9 ? O43521 108 ? 116 ? 1 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 2 1 3D_13C-separated_NOESY 3 3 1 '2D NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1.5mM DLC8/Bim peptide complex 15N; 100mM phosphate buffer; 10mM DTT; 90% H2O and 10% D2O' '90% H2O and 10% D2O' 2 '1.5mM DLC8/Bim peptide complex 15N,13C; 100mM phosphate buffer; 10mM DTT; 90% H2O and 10% D2O' '90% H2O and 10% D2O' 3 '1.5mM DLC8/Bim peptide complex ; 100mM phosphate buffer; 10mM DTT; 99.9% D2O' '99.9% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 500 2 ? Varian INOVA 750 # _pdbx_nmr_refine.entry_id 1F95 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1F95 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1F95 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR 6.1b collection varian 1 NMRPipe 1.7 processing ? 2 X-PLOR 3.8 'structure solution' ? 3 CNS 1.0 refinement ? 4 # _exptl.entry_id 1F95 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1F95 _struct.title 'SOLUTION STRUCTURE OF DYNEIN LIGHT CHAIN 8 (DLC8) AND BIM PEPTIDE COMPLEX' _struct.pdbx_descriptor DYNEIN _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1F95 _struct_keywords.pdbx_keywords 'CONTRACTILE PROTEIN/peptide' _struct_keywords.text 'dynein, light chain, DLC8, Bim, APOPTOSIS, CONTRACTILE PROTEIN-peptide complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 14 ? TYR A 32 ? SER A 14 TYR A 32 1 ? 19 HELX_P HELX_P2 2 ILE A 34 ? TYR A 50 ? ILE A 34 TYR A 50 1 ? 17 HELX_P HELX_P3 3 SER B 14 ? TYR B 32 ? SER B 14 TYR B 32 1 ? 19 HELX_P HELX_P4 4 ILE B 34 ? TYR B 50 ? ILE B 34 TYR B 50 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 1 0.80 2 PRO 52 B . ? PRO 52 B THR 53 B ? THR 53 B 1 0.54 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel A 9 10 ? anti-parallel A 11 12 ? anti-parallel A 13 14 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 6 ? MET A 13 ? ALA A 6 MET A 13 A 2 HIS A 72 ? LEU A 78 ? HIS A 72 LEU A 78 A 3 VAL A 81 ? LYS A 87 ? VAL A 81 LYS A 87 A 4 TRP A 54 ? VAL A 66 ? TRP A 54 VAL A 66 A 5 LYS C 5 ? GLN C 8 ? LYS C 5 GLN C 8 A 6 TRP A 54 ? VAL A 66 ? TRP A 54 VAL A 66 A 7 TRP B 54 ? HIS B 68 ? TRP B 54 HIS B 68 A 8 VAL B 81 ? LYS B 87 ? VAL B 81 LYS B 87 A 9 HIS B 72 ? LEU B 78 ? HIS B 72 LEU B 78 A 10 ALA B 6 ? MET B 13 ? ALA B 6 MET B 13 A 11 TRP A 54 ? VAL A 66 ? TRP A 54 VAL A 66 A 12 LYS C 5 ? GLN C 8 ? LYS C 5 GLN C 8 A 13 TRP B 54 ? HIS B 68 ? TRP B 54 HIS B 68 A 14 CYS D 3 ? GLN D 8 ? CYS D 3 GLN D 8 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASP A 12 ? N ASP A 12 O PHE A 73 ? O PHE A 73 A 2 3 N LEU A 78 ? N LEU A 78 O VAL A 81 ? O VAL A 81 A 3 4 O PHE A 86 ? O PHE A 86 N HIS A 55 ? N HIS A 55 A 4 5 O VAL A 66 ? O VAL A 66 N LYS C 5 ? N LYS C 5 A 6 7 O TYR A 65 ? O TYR A 65 N CYS B 56 ? N CYS B 56 A 7 8 O GLY B 59 ? O GLY B 59 N ALA B 82 ? N ALA B 82 A 8 9 N LYS B 87 ? N LYS B 87 O HIS B 72 ? O HIS B 72 A 9 10 N TYR B 77 ? N TYR B 77 O VAL B 7 ? O VAL B 7 A 11 12 O VAL A 66 ? O VAL A 66 N LYS C 5 ? N LYS C 5 A 13 14 N HIS B 68 ? N HIS B 68 O CYS D 3 ? O CYS D 3 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 16 'BINDING SITE FOR CHAIN C OF BCL2-LIKE 11 (APOPTOSIS FACILITATOR)' AC2 Software ? ? ? ? 18 'BINDING SITE FOR CHAIN D OF BCL2-LIKE 11 (APOPTOSIS FACILITATOR)' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 16 ASN A 61 ? ASN A 61 . ? 1_555 ? 2 AC1 16 PHE A 62 ? PHE A 62 . ? 1_555 ? 3 AC1 16 GLY A 63 ? GLY A 63 . ? 1_555 ? 4 AC1 16 SER A 64 ? SER A 64 . ? 1_555 ? 5 AC1 16 TYR A 65 ? TYR A 65 . ? 1_555 ? 6 AC1 16 VAL A 66 ? VAL A 66 . ? 1_555 ? 7 AC1 16 THR A 67 ? THR A 67 . ? 1_555 ? 8 AC1 16 HIS A 68 ? HIS A 68 . ? 1_555 ? 9 AC1 16 GLU A 69 ? GLU A 69 . ? 1_555 ? 10 AC1 16 THR A 70 ? THR A 70 . ? 1_555 ? 11 AC1 16 PHE A 73 ? PHE A 73 . ? 1_555 ? 12 AC1 16 TYR A 75 ? TYR A 75 . ? 1_555 ? 13 AC1 16 TYR A 77 ? TYR A 77 . ? 1_555 ? 14 AC1 16 ALA A 82 ? ALA A 82 . ? 1_555 ? 15 AC1 16 LEU A 84 ? LEU A 84 . ? 1_555 ? 16 AC1 16 LYS B 36 ? LYS B 36 . ? 1_555 ? 17 AC2 18 ILE A 34 ? ILE A 34 . ? 1_555 ? 18 AC2 18 GLU A 35 ? GLU A 35 . ? 1_555 ? 19 AC2 18 LYS A 36 ? LYS A 36 . ? 1_555 ? 20 AC2 18 ASN B 10 ? ASN B 10 . ? 1_555 ? 21 AC2 18 GLY B 59 ? GLY B 59 . ? 1_555 ? 22 AC2 18 ASN B 61 ? ASN B 61 . ? 1_555 ? 23 AC2 18 PHE B 62 ? PHE B 62 . ? 1_555 ? 24 AC2 18 GLY B 63 ? GLY B 63 . ? 1_555 ? 25 AC2 18 SER B 64 ? SER B 64 . ? 1_555 ? 26 AC2 18 TYR B 65 ? TYR B 65 . ? 1_555 ? 27 AC2 18 VAL B 66 ? VAL B 66 . ? 1_555 ? 28 AC2 18 THR B 67 ? THR B 67 . ? 1_555 ? 29 AC2 18 HIS B 68 ? HIS B 68 . ? 1_555 ? 30 AC2 18 GLU B 69 ? GLU B 69 . ? 1_555 ? 31 AC2 18 THR B 70 ? THR B 70 . ? 1_555 ? 32 AC2 18 TYR B 75 ? TYR B 75 . ? 1_555 ? 33 AC2 18 ALA B 82 ? ALA B 82 . ? 1_555 ? 34 AC2 18 LEU B 84 ? LEU B 84 . ? 1_555 ? # _database_PDB_matrix.entry_id 1F95 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1F95 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 GLY 89 89 89 GLY GLY A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 CYS 2 2 2 CYS CYS B . n B 1 3 ASP 3 3 3 ASP ASP B . n B 1 4 ARG 4 4 4 ARG ARG B . n B 1 5 LYS 5 5 5 LYS LYS B . n B 1 6 ALA 6 6 6 ALA ALA B . n B 1 7 VAL 7 7 7 VAL VAL B . n B 1 8 ILE 8 8 8 ILE ILE B . n B 1 9 LYS 9 9 9 LYS LYS B . n B 1 10 ASN 10 10 10 ASN ASN B . n B 1 11 ALA 11 11 11 ALA ALA B . n B 1 12 ASP 12 12 12 ASP ASP B . n B 1 13 MET 13 13 13 MET MET B . n B 1 14 SER 14 14 14 SER SER B . n B 1 15 GLU 15 15 15 GLU GLU B . n B 1 16 GLU 16 16 16 GLU GLU B . n B 1 17 MET 17 17 17 MET MET B . n B 1 18 GLN 18 18 18 GLN GLN B . n B 1 19 GLN 19 19 19 GLN GLN B . n B 1 20 ASP 20 20 20 ASP ASP B . n B 1 21 SER 21 21 21 SER SER B . n B 1 22 VAL 22 22 22 VAL VAL B . n B 1 23 GLU 23 23 23 GLU GLU B . n B 1 24 CYS 24 24 24 CYS CYS B . n B 1 25 ALA 25 25 25 ALA ALA B . n B 1 26 THR 26 26 26 THR THR B . n B 1 27 GLN 27 27 27 GLN GLN B . n B 1 28 ALA 28 28 28 ALA ALA B . n B 1 29 LEU 29 29 29 LEU LEU B . n B 1 30 GLU 30 30 30 GLU GLU B . n B 1 31 LYS 31 31 31 LYS LYS B . n B 1 32 TYR 32 32 32 TYR TYR B . n B 1 33 ASN 33 33 33 ASN ASN B . n B 1 34 ILE 34 34 34 ILE ILE B . n B 1 35 GLU 35 35 35 GLU GLU B . n B 1 36 LYS 36 36 36 LYS LYS B . n B 1 37 ASP 37 37 37 ASP ASP B . n B 1 38 ILE 38 38 38 ILE ILE B . n B 1 39 ALA 39 39 39 ALA ALA B . n B 1 40 ALA 40 40 40 ALA ALA B . n B 1 41 HIS 41 41 41 HIS HIS B . n B 1 42 ILE 42 42 42 ILE ILE B . n B 1 43 LYS 43 43 43 LYS LYS B . n B 1 44 LYS 44 44 44 LYS LYS B . n B 1 45 GLU 45 45 45 GLU GLU B . n B 1 46 PHE 46 46 46 PHE PHE B . n B 1 47 ASP 47 47 47 ASP ASP B . n B 1 48 LYS 48 48 48 LYS LYS B . n B 1 49 LYS 49 49 49 LYS LYS B . n B 1 50 TYR 50 50 50 TYR TYR B . n B 1 51 ASN 51 51 51 ASN ASN B . n B 1 52 PRO 52 52 52 PRO PRO B . n B 1 53 THR 53 53 53 THR THR B . n B 1 54 TRP 54 54 54 TRP TRP B . n B 1 55 HIS 55 55 55 HIS HIS B . n B 1 56 CYS 56 56 56 CYS CYS B . n B 1 57 ILE 57 57 57 ILE ILE B . n B 1 58 VAL 58 58 58 VAL VAL B . n B 1 59 GLY 59 59 59 GLY GLY B . n B 1 60 ARG 60 60 60 ARG ARG B . n B 1 61 ASN 61 61 61 ASN ASN B . n B 1 62 PHE 62 62 62 PHE PHE B . n B 1 63 GLY 63 63 63 GLY GLY B . n B 1 64 SER 64 64 64 SER SER B . n B 1 65 TYR 65 65 65 TYR TYR B . n B 1 66 VAL 66 66 66 VAL VAL B . n B 1 67 THR 67 67 67 THR THR B . n B 1 68 HIS 68 68 68 HIS HIS B . n B 1 69 GLU 69 69 69 GLU GLU B . n B 1 70 THR 70 70 70 THR THR B . n B 1 71 LYS 71 71 71 LYS LYS B . n B 1 72 HIS 72 72 72 HIS HIS B . n B 1 73 PHE 73 73 73 PHE PHE B . n B 1 74 ILE 74 74 74 ILE ILE B . n B 1 75 TYR 75 75 75 TYR TYR B . n B 1 76 PHE 76 76 76 PHE PHE B . n B 1 77 TYR 77 77 77 TYR TYR B . n B 1 78 LEU 78 78 78 LEU LEU B . n B 1 79 GLY 79 79 79 GLY GLY B . n B 1 80 GLN 80 80 80 GLN GLN B . n B 1 81 VAL 81 81 81 VAL VAL B . n B 1 82 ALA 82 82 82 ALA ALA B . n B 1 83 ILE 83 83 83 ILE ILE B . n B 1 84 LEU 84 84 84 LEU LEU B . n B 1 85 LEU 85 85 85 LEU LEU B . n B 1 86 PHE 86 86 86 PHE PHE B . n B 1 87 LYS 87 87 87 LYS LYS B . n B 1 88 SER 88 88 88 SER SER B . n B 1 89 GLY 89 89 89 GLY GLY B . n C 2 1 MET 1 1 1 MET MET C . n C 2 2 SER 2 2 2 SER SER C . n C 2 3 CYS 3 3 3 CYS CYS C . n C 2 4 ASP 4 4 4 ASP ASP C . n C 2 5 LYS 5 5 5 LYS LYS C . n C 2 6 SER 6 6 6 SER SER C . n C 2 7 THR 7 7 7 THR THR C . n C 2 8 GLN 8 8 8 GLN GLN C . n C 2 9 THR 9 9 9 THR THR C . n D 2 1 MET 1 1 1 MET MET D . n D 2 2 SER 2 2 2 SER SER D . n D 2 3 CYS 3 3 3 CYS CYS D . n D 2 4 ASP 4 4 4 ASP ASP D . n D 2 5 LYS 5 5 5 LYS LYS D . n D 2 6 SER 6 6 6 SER SER D . n D 2 7 THR 7 7 7 THR THR D . n D 2 8 GLN 8 8 8 GLN GLN D . n D 2 9 THR 9 9 9 THR THR D . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-02-28 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Non-polymer description' 6 3 'Structure model' 'Structure summary' 7 3 'Structure model' 'Version format compliance' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 THR _pdbx_validate_close_contact.auth_seq_id_1 70 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HD1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HIS _pdbx_validate_close_contact.auth_seq_id_2 72 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 3 ? ? 43.23 -138.71 2 1 ASP A 12 ? ? -150.07 70.07 3 1 ASN A 33 ? ? -94.37 32.22 4 1 ASN A 51 ? ? 84.33 141.02 5 1 ASN A 61 ? ? -171.16 134.47 6 1 PHE A 62 ? ? 179.20 -170.98 7 1 GLU A 69 ? ? -85.28 -122.79 8 1 GLN A 80 ? ? 82.68 -26.80 9 1 PHE A 86 ? ? -177.11 140.38 10 1 SER A 88 ? ? -154.62 43.45 11 1 CYS B 2 ? ? -177.92 46.01 12 1 ARG B 4 ? ? -177.02 130.12 13 1 VAL B 7 ? ? -156.82 66.53 14 1 ASN B 10 ? ? -174.84 144.42 15 1 ASN B 51 ? ? 78.46 139.94 16 1 PHE B 62 ? ? 178.35 144.79 17 1 HIS B 68 ? ? -128.93 -169.85 18 1 GLU B 69 ? ? -81.95 -125.65 19 1 GLN B 80 ? ? -90.37 42.73 20 1 PHE B 86 ? ? -178.50 141.95 21 1 SER B 88 ? ? -153.31 44.78 22 1 CYS C 3 ? ? 174.73 145.60 23 1 SER D 2 ? ? -169.09 112.56 24 1 CYS D 3 ? ? -170.59 127.50 #