data_1FEW # _entry.id 1FEW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1FEW RCSB RCSB011525 WWPDB D_1000011525 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1FEW _pdbx_database_status.recvd_initial_deposition_date 2000-07-23 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chai, J.' 1 'Shi, Y.' 2 # _citation.id primary _citation.title 'Structural and biochemical basis of apoptotic activation by Smac/DIABLO.' _citation.journal_abbrev Nature _citation.journal_volume 406 _citation.page_first 855 _citation.page_last 862 _citation.year 2000 _citation.journal_id_ASTM NATUAS _citation.country UK _citation.journal_id_ISSN 0028-0836 _citation.journal_id_CSD 0006 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10972280 _citation.pdbx_database_id_DOI 10.1038/35022514 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Chai, J.' 1 primary 'Du, C.' 2 primary 'Wu, J.W.' 3 primary 'Kyin, S.' 4 primary 'Wang, X.' 5 primary 'Shi, Y.' 6 # _cell.entry_id 1FEW _cell.length_a 108.5 _cell.length_b 108.5 _cell.length_c 70.4 _cell.angle_alpha 90 _cell.angle_beta 90 _cell.angle_gamma 120 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1FEW _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SECOND MITOCHONDRIA-DERIVED ACTIVATOR OF CASPASES' _entity.formula_weight 20759.084 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment SMAC/DIABLO _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQV IIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEE LKQKTQEEGEERAESEQEAYLRED ; _entity_poly.pdbx_seq_one_letter_code_can ;AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQV IIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEE LKQKTQEEGEERAESEQEAYLRED ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 VAL n 1 3 PRO n 1 4 ILE n 1 5 ALA n 1 6 GLN n 1 7 LYS n 1 8 SER n 1 9 GLU n 1 10 PRO n 1 11 HIS n 1 12 SER n 1 13 LEU n 1 14 SER n 1 15 SER n 1 16 GLU n 1 17 ALA n 1 18 LEU n 1 19 MET n 1 20 ARG n 1 21 ARG n 1 22 ALA n 1 23 VAL n 1 24 SER n 1 25 LEU n 1 26 VAL n 1 27 THR n 1 28 ASP n 1 29 SER n 1 30 THR n 1 31 SER n 1 32 THR n 1 33 PHE n 1 34 LEU n 1 35 SER n 1 36 GLN n 1 37 THR n 1 38 THR n 1 39 TYR n 1 40 ALA n 1 41 LEU n 1 42 ILE n 1 43 GLU n 1 44 ALA n 1 45 ILE n 1 46 THR n 1 47 GLU n 1 48 TYR n 1 49 THR n 1 50 LYS n 1 51 ALA n 1 52 VAL n 1 53 TYR n 1 54 THR n 1 55 LEU n 1 56 THR n 1 57 SER n 1 58 LEU n 1 59 TYR n 1 60 ARG n 1 61 GLN n 1 62 TYR n 1 63 THR n 1 64 SER n 1 65 LEU n 1 66 LEU n 1 67 GLY n 1 68 LYS n 1 69 MET n 1 70 ASN n 1 71 SER n 1 72 GLU n 1 73 GLU n 1 74 GLU n 1 75 ASP n 1 76 GLU n 1 77 VAL n 1 78 TRP n 1 79 GLN n 1 80 VAL n 1 81 ILE n 1 82 ILE n 1 83 GLY n 1 84 ALA n 1 85 ARG n 1 86 ALA n 1 87 GLU n 1 88 MET n 1 89 THR n 1 90 SER n 1 91 LYS n 1 92 HIS n 1 93 GLN n 1 94 GLU n 1 95 TYR n 1 96 LEU n 1 97 LYS n 1 98 LEU n 1 99 GLU n 1 100 THR n 1 101 THR n 1 102 TRP n 1 103 MET n 1 104 THR n 1 105 ALA n 1 106 VAL n 1 107 GLY n 1 108 LEU n 1 109 SER n 1 110 GLU n 1 111 MET n 1 112 ALA n 1 113 ALA n 1 114 GLU n 1 115 ALA n 1 116 ALA n 1 117 TYR n 1 118 GLN n 1 119 THR n 1 120 GLY n 1 121 ALA n 1 122 ASP n 1 123 GLN n 1 124 ALA n 1 125 SER n 1 126 ILE n 1 127 THR n 1 128 ALA n 1 129 ARG n 1 130 ASN n 1 131 HIS n 1 132 ILE n 1 133 GLN n 1 134 LEU n 1 135 VAL n 1 136 LYS n 1 137 LEU n 1 138 GLN n 1 139 VAL n 1 140 GLU n 1 141 GLU n 1 142 VAL n 1 143 HIS n 1 144 GLN n 1 145 LEU n 1 146 SER n 1 147 ARG n 1 148 LYS n 1 149 ALA n 1 150 GLU n 1 151 THR n 1 152 LYS n 1 153 LEU n 1 154 ALA n 1 155 GLU n 1 156 ALA n 1 157 GLN n 1 158 ILE n 1 159 GLU n 1 160 GLU n 1 161 LEU n 1 162 LYS n 1 163 GLN n 1 164 LYS n 1 165 THR n 1 166 GLN n 1 167 GLU n 1 168 GLU n 1 169 GLY n 1 170 GLU n 1 171 GLU n 1 172 ARG n 1 173 ALA n 1 174 GLU n 1 175 SER n 1 176 GLU n 1 177 GLN n 1 178 GLU n 1 179 ALA n 1 180 TYR n 1 181 LEU n 1 182 ARG n 1 183 GLU n 1 184 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-15B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_code DBLOH_HUMAN _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q9NR28 _struct_ref.pdbx_align_begin 56 _struct_ref.pdbx_seq_one_letter_code ;AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQV IIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEE LRQKTQEEGEERAESEQEAYLRED ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1FEW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 184 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NR28 _struct_ref_seq.db_align_beg 56 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 239 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 184 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1FEW _struct_ref_seq_dif.mon_id LYS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 162 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9NR28 _struct_ref_seq_dif.db_mon_id ARG _struct_ref_seq_dif.pdbx_seq_db_seq_num 217 _struct_ref_seq_dif.details CONFLICT _struct_ref_seq_dif.pdbx_auth_seq_num 162 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1FEW _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 57.30 _exptl_crystal.density_Matthews 2.88 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.temp 276.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details 'Dioxane, Ammonium Sulfate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 276.0K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS' _diffrn_detector.pdbx_collection_date 2000-01-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1FEW _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 99 _reflns.d_resolution_high 2.2 _reflns.number_obs 12842 _reflns.number_all 12907 _reflns.percent_possible_obs 99.5 _reflns.pdbx_Rmerge_I_obs 0.0470000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 16.3 _reflns.B_iso_Wilson_estimate 37 _reflns.pdbx_redundancy 6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.2 _reflns_shell.d_res_low 2.28 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 97.9 _reflns_shell.Rmerge_I_obs 0.2420000 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy 2.5 _reflns_shell.number_unique_all 1219 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1FEW _refine.ls_number_reflns_obs 11728 _refine.ls_number_reflns_all 12831 _refine.pdbx_ls_sigma_I 2 _refine.pdbx_ls_sigma_F 2 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 15 _refine.ls_d_res_high 2.2 _refine.ls_percent_reflns_obs 91.4 _refine.ls_R_factor_obs 0.2470000 _refine.ls_R_factor_all 0.2500000 _refine.ls_R_factor_R_work 0.2450000 _refine.ls_R_factor_R_free 0.2590000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 622 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details 'Used weighted full matrix least squares procedure.' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details random _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1373 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1373 _refine_hist.d_res_high 2.2 _refine_hist.d_res_low 15 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.012 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1FEW _struct.title 'CRYSTAL STRUCTURE OF SMAC/DIABLO' _struct.pdbx_descriptor 'SECOND MITOCHONDRIA-DERIVED ACTIVATOR OF CASPASES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1FEW _struct_keywords.pdbx_keywords APOPTOSIS _struct_keywords.text 'Smac, DIABLO, apoptosis, caspase activation, IAP inhibition' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ;The biological assembly is a dimer constructed from chain A a symmetry partner generated by the two-fold. ; _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 12 ? LEU A 66 ? SER A 12 LEU A 66 1 ? 55 HELX_P HELX_P2 2 ASN A 70 ? THR A 119 ? ASN A 70 THR A 119 1 ? 50 HELX_P HELX_P3 3 ALA A 121 ? ARG A 182 ? ALA A 121 ARG A 182 1 ? 62 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1FEW _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1FEW _atom_sites.fract_transf_matrix[1][1] 0.009217 _atom_sites.fract_transf_matrix[1][2] 0.005321 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010642 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014205 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 VAL 2 2 ? ? ? A . n A 1 3 PRO 3 3 ? ? ? A . n A 1 4 ILE 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 GLN 6 6 ? ? ? A . n A 1 7 LYS 7 7 ? ? ? A . n A 1 8 SER 8 8 ? ? ? A . n A 1 9 GLU 9 9 ? ? ? A . n A 1 10 PRO 10 10 ? ? ? A . n A 1 11 HIS 11 11 ? ? ? A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 TRP 78 78 78 TRP TRP A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 TRP 102 102 102 TRP TRP A . n A 1 103 MET 103 103 103 MET MET A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 ASN 130 130 130 ASN ASN A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 GLN 144 144 144 GLN GLN A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 GLN 157 157 157 GLN GLN A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 LYS 164 164 164 LYS LYS A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 GLN 177 177 177 GLN GLN A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 TYR 180 180 180 TYR TYR A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 ARG 182 182 182 ARG ARG A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 ASP 184 184 184 ASP ASP A . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 software_defined_assembly PISA,PQS dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2 A 2 1,3 A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2210 ? 1 MORE -9 ? 1 'SSA (A^2)' 20320 ? 2 'ABSA (A^2)' 2000 ? 2 MORE -21 ? 2 'SSA (A^2)' 20530 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z+1/3 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 23.4666666667 3 'crystal symmetry operation' 10_664 -y+1,-x+1,-z-1/6 0.5000000000 -0.8660254038 0.0000000000 54.2500000000 -0.8660254038 -0.5000000000 0.0000000000 93.9637563106 0.0000000000 0.0000000000 -1.0000000000 -11.7333333333 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-09-13 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DM 'model building' . ? 1 CNS refinement . ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 DM phasing . ? 5 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NH1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ARG _pdbx_validate_symm_contact.auth_seq_id_1 182 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NH1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ARG _pdbx_validate_symm_contact.auth_seq_id_2 182 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 11_556 _pdbx_validate_symm_contact.dist 1.80 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 68 ? ? 119.61 -88.75 2 1 MET A 69 ? ? 41.53 -92.58 3 1 ARG A 182 ? ? -71.54 30.22 4 1 GLU A 183 ? ? 86.91 93.23 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1 ? A ALA 1 2 1 Y 1 A VAL 2 ? A VAL 2 3 1 Y 1 A PRO 3 ? A PRO 3 4 1 Y 1 A ILE 4 ? A ILE 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A GLN 6 ? A GLN 6 7 1 Y 1 A LYS 7 ? A LYS 7 8 1 Y 1 A SER 8 ? A SER 8 9 1 Y 1 A GLU 9 ? A GLU 9 10 1 Y 1 A PRO 10 ? A PRO 10 11 1 Y 1 A HIS 11 ? A HIS 11 #