data_1FFJ # _entry.id 1FFJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1FFJ pdb_00001ffj 10.2210/pdb1ffj/pdb RCSB RCSB011541 ? ? WWPDB D_1000011541 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1CB9 _pdbx_database_related.details '1CB9 is the Solution Structure of Cardiotoxin from Naja oxiana (major form)' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1FFJ _pdbx_database_status.recvd_initial_deposition_date 2000-07-25 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dubovskii, P.V.' 1 'Dementieva, D.V.' 2 'Bocharov, E.V.' 3 'Utkin, Y.N.' 4 'Arseniev, A.S.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Membrane binding motif of the P-type cardiotoxin.' J.Mol.Biol. 305 137 149 2001 JMOBAK UK 0022-2836 0070 ? 11114253 10.1006/jmbi.2000.4283 1 ;Two forms of Cytotoxin II (cardiotoxin) from Naja naja oxiana in Aqueous Solution. Spatial Structures with Tightly Bound Water Molecules ; Eur.J.Biochem. 263 152 162 1999 EJBCAI IX 0014-2956 0262 ? ? 10.1046/j.1432-1327.1999.00478.x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dubovskii, P.V.' 1 ? primary 'Dementieva, D.V.' 2 ? primary 'Bocharov, E.V.' 3 ? primary 'Utkin, Y.N.' 4 ? primary 'Arseniev, A.S.' 5 ? 1 'Dementieva, D.V.' 6 ? 1 'Bocharov, E.V.' 7 ? 1 'Arseniev, A.S.' 8 ? # _cell.entry_id 1FFJ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1FFJ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'CYTOTOXIN 2' 6648.238 1 ? ? 1 ? 2 water nat water 18.015 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name CARDIOTOXIN # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN _entity_poly.pdbx_seq_one_letter_code_can LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 LYS n 1 3 CYS n 1 4 LYS n 1 5 LYS n 1 6 LEU n 1 7 VAL n 1 8 PRO n 1 9 LEU n 1 10 PHE n 1 11 SER n 1 12 LYS n 1 13 THR n 1 14 CYS n 1 15 PRO n 1 16 ALA n 1 17 GLY n 1 18 LYS n 1 19 ASN n 1 20 LEU n 1 21 CYS n 1 22 TYR n 1 23 LYS n 1 24 MET n 1 25 PHE n 1 26 MET n 1 27 VAL n 1 28 ALA n 1 29 ALA n 1 30 PRO n 1 31 HIS n 1 32 VAL n 1 33 PRO n 1 34 VAL n 1 35 LYS n 1 36 ARG n 1 37 GLY n 1 38 CYS n 1 39 ILE n 1 40 ASP n 1 41 VAL n 1 42 CYS n 1 43 PRO n 1 44 LYS n 1 45 SER n 1 46 SER n 1 47 LEU n 1 48 LEU n 1 49 VAL n 1 50 LYS n 1 51 TYR n 1 52 VAL n 1 53 CYS n 1 54 CYS n 1 55 ASN n 1 56 THR n 1 57 ASP n 1 58 LYS n 1 59 CYS n 1 60 ASN n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'Central Asian cobra' _entity_src_nat.pdbx_organism_scientific 'Naja oxiana' _entity_src_nat.pdbx_ncbi_taxonomy_id 8657 _entity_src_nat.genus Naja _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion VENOM _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_code CX2_NAJOX _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01441 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1FFJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 60 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01441 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 60 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 60 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 TOCSY 3 1 1 DQF-COSY 4 1 1 ROESY 5 2 1 DQF-COSY 6 2 1 '2D NOESY' 7 2 1 TOCSY 8 1 2 ROESY 9 1 2 DQF-COSY 10 1 2 '2D NOESY' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 318 ambient 5.5 '0M NaCl' ? K 2 303 ambient 5.5 '0M NaCl' ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '3mM Cardiotoxin (cytotoxin II); 120 mM perdeuterated dodecylphosphocholine' '90% H2O/10% D2O' 2 '3mM Cardiotoxin (cytotoxin II); 120 mM perdeuterated dodecylphosphocholine' '100% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model UNITY _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1FFJ _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;structures are based on a total of 368 NOE-derived constraints, 154 dihedral angle restraints, 248 distance restraints from hydrogen bonds and disulfides ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1FFJ _pdbx_nmr_details.text ;This structure was determined using standard 2D homonuclear techniques. Sites of tightly bound water molecules were determined as in Dementieva et al., Eur.J.Biochem.1999,263,152-162. ; # _pdbx_nmr_ensemble.entry_id 1FFJ _pdbx_nmr_ensemble.conformers_calculated_total_number 220 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1FFJ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR 6.1A collection 'Varian software' 1 XEASY 1.2.11 'data analysis' 'Xia, T. & Bartels, C.' 2 DYANA 1.5 'structure solution' 'Guentert, P. & Mumenthaler, C.' 3 DYANA 1.5 refinement 'Guentert, P. & Mumenthaler, C.' 4 # _exptl.entry_id 1FFJ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1FFJ _struct.title 'NMR STRUCTURE OF CARDIOTOXIN IN DPC-MICELLE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1FFJ _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'all-beta sheet protein, membrane perturbation, TOXIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 3 A CYS 21 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 14 A CYS 38 1_555 ? ? ? ? ? ? ? 1.979 ? ? disulf3 disulf ? ? A CYS 42 SG ? ? ? 1_555 A CYS 53 SG ? ? A CYS 42 A CYS 53 1_555 ? ? ? ? ? ? ? 2.080 ? ? disulf4 disulf ? ? A CYS 54 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 54 A CYS 59 1_555 ? ? ? ? ? ? ? 2.088 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 2 ? LYS A 4 ? LYS A 2 LYS A 4 A 2 SER A 11 ? THR A 13 ? SER A 11 THR A 13 B 1 PRO A 33 ? ILE A 39 ? PRO A 33 ILE A 39 B 2 LEU A 20 ? MET A 26 ? LEU A 20 MET A 26 B 3 VAL A 49 ? CYS A 54 ? VAL A 49 CYS A 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O CYS A 3 ? O CYS A 3 N LYS A 12 ? N LYS A 12 B 1 2 N ILE A 39 ? N ILE A 39 O LEU A 20 ? O LEU A 20 B 2 3 O PHE A 25 ? O PHE A 25 N LYS A 50 ? N LYS A 50 # _database_PDB_matrix.entry_id 1FFJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1FFJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 ASN 60 60 60 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 61 61 HOH HOH A . B 2 HOH 2 62 62 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-01-17 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A MET 26 ? ? O A HOH 61 ? ? 1.52 2 2 H A MET 26 ? ? O A HOH 61 ? ? 1.25 3 2 HG A SER 46 ? ? O A VAL 49 ? ? 1.58 4 4 H A MET 26 ? ? O A HOH 61 ? ? 1.39 5 5 H A MET 26 ? ? O A HOH 61 ? ? 1.45 6 6 H A MET 26 ? ? O A HOH 61 ? ? 1.41 7 7 H A MET 26 ? ? O A HOH 61 ? ? 1.59 8 8 H A MET 26 ? ? O A HOH 61 ? ? 1.50 9 9 HG A SER 46 ? ? O A VAL 49 ? ? 1.54 10 10 H A MET 26 ? ? O A HOH 61 ? ? 1.55 11 11 H A MET 26 ? ? O A HOH 61 ? ? 1.40 12 12 O A MET 26 ? ? H1 A HOH 61 ? ? 1.52 13 12 O A MET 26 ? ? O A HOH 61 ? ? 2.02 14 14 H A MET 26 ? ? O A HOH 61 ? ? 1.32 15 16 H A MET 26 ? ? O A HOH 61 ? ? 1.23 16 16 HG A SER 46 ? ? O A VAL 49 ? ? 1.58 17 17 H A MET 26 ? ? O A HOH 61 ? ? 1.19 18 17 N A MET 26 ? ? O A HOH 61 ? ? 2.17 19 18 H A MET 26 ? ? O A HOH 61 ? ? 1.45 20 19 H A MET 26 ? ? O A HOH 61 ? ? 1.21 21 19 HZ2 A LYS 18 ? ? HD2 A ASP 40 ? ? 1.27 22 20 H A MET 26 ? ? O A HOH 61 ? ? 1.24 23 20 N A MET 26 ? ? O A HOH 61 ? ? 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 32 ? ? -155.90 87.22 2 1 ASN A 55 ? ? -105.26 63.75 3 2 ALA A 28 ? ? -37.03 -38.49 4 2 VAL A 32 ? ? -157.11 78.58 5 2 ASN A 55 ? ? -108.13 70.35 6 3 LEU A 6 ? ? -40.69 -71.70 7 3 VAL A 32 ? ? -157.41 78.46 8 3 ASN A 55 ? ? -107.53 63.61 9 4 VAL A 32 ? ? -153.07 84.04 10 4 ASN A 55 ? ? -113.87 70.59 11 5 ALA A 16 ? ? -40.18 155.02 12 5 ALA A 28 ? ? -37.14 -39.17 13 5 VAL A 32 ? ? -158.75 84.94 14 5 ASN A 55 ? ? -118.81 63.38 15 6 LEU A 6 ? ? -42.81 -70.23 16 6 ALA A 16 ? ? -48.35 156.07 17 6 VAL A 32 ? ? -152.21 85.45 18 7 VAL A 32 ? ? -156.59 74.41 19 7 ASN A 55 ? ? -103.27 69.03 20 8 LEU A 6 ? ? -39.77 -73.30 21 8 ALA A 16 ? ? -42.30 157.77 22 8 VAL A 32 ? ? -158.35 81.26 23 9 ALA A 16 ? ? -40.31 157.36 24 9 HIS A 31 ? ? -142.21 57.54 25 9 ASN A 55 ? ? -109.77 65.90 26 10 LEU A 6 ? ? -40.75 -72.13 27 10 VAL A 32 ? ? -151.68 87.29 28 10 ASN A 55 ? ? -110.81 66.10 29 11 ALA A 16 ? ? -44.69 158.74 30 11 VAL A 32 ? ? -155.12 83.94 31 12 LYS A 5 ? ? -75.59 -167.04 32 12 VAL A 32 ? ? -156.59 80.75 33 12 CYS A 54 ? ? -171.41 143.27 34 12 ASN A 55 ? ? -103.61 62.12 35 13 ALA A 16 ? ? -43.49 163.41 36 13 ASN A 55 ? ? -110.87 66.27 37 14 VAL A 32 ? ? -157.54 84.02 38 15 HIS A 31 ? ? -140.28 48.19 39 15 ASN A 55 ? ? -112.65 66.34 40 16 ALA A 16 ? ? -40.01 158.07 41 16 ASN A 55 ? ? -105.70 69.38 42 17 ALA A 16 ? ? -41.10 151.80 43 17 ASN A 55 ? ? -108.18 60.88 44 18 LEU A 6 ? ? -42.25 -73.32 45 18 ALA A 16 ? ? -43.78 156.09 46 18 VAL A 32 ? ? -156.95 85.31 47 18 CYS A 54 ? ? -170.62 139.03 48 18 ASN A 55 ? ? -101.73 58.01 49 19 ALA A 16 ? ? -45.88 151.21 50 19 ALA A 28 ? ? -36.90 -36.95 51 19 VAL A 32 ? ? -151.75 88.43 52 19 ASN A 55 ? ? -104.19 64.45 53 20 ALA A 16 ? ? -42.49 150.88 54 20 HIS A 31 ? ? -142.61 54.54 55 20 VAL A 32 ? ? -152.70 87.83 56 20 CYS A 54 ? ? -170.37 144.61 57 20 ASN A 55 ? ? -105.74 58.54 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #