data_1FHG # _entry.id 1FHG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1FHG RCSB RCSB011590 WWPDB D_1000011590 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1tlk _pdbx_database_related.details 'Low resolution refinement' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1FHG _pdbx_database_status.recvd_initial_deposition_date 2000-08-01 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tomchick, D.R.' 1 'Minor, W.' 2 'Kiyatkin, A.' 3 'Lewinski, K.' 4 'Somlyo, A.V.' 5 'Somlyo, A.P.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'X-ray structure determination of telokin, the C-terminal domain of myosin light chain kinase, at 2.8 A resolution.' J.Mol.Biol. 227 840 851 1992 JMOBAK UK 0022-2836 0070 ? 1404391 '10.1016/0022-2836(92)90226-A' 1 'X-Ray Structure Determination of Telokin, the C-terminal Domain of Myosin Light Chain Kinase, at 2.8 Angstroms Resolution' J.Mol.Biol. 227 840 851 1992 JMOBAK UK 0022-2836 0070 ? ? ? 2 'Regulation of the Cross-bridge Cycle: the Effects of MgADP, LC17 Isoforms and Telokin.' 'ACTA PHYSIOL.SCAND.' 164 381 388 1998 ? UK 0001-6772 ? ? ? 10.1046/j.1365-201X.1998.00454.x 3 ;Acceleration of Myosin Light Chain Dephosphorylation and Relaxation of Smooth Muscle by Telokin. Synergism with Cyclic Nucleotide-activated Kinase. ; J.Biol.Chem. 273 11362 11369 1998 JBCHA3 US 0021-9258 0071 ? ? 10.1074/jbc.273.18.11362 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Holden, H.M.' 1 primary 'Ito, M.' 2 primary 'Hartshorne, D.J.' 3 primary 'Rayment, I.' 4 1 'Holden, H.M.' 5 1 'Ito, M.' 6 1 'Hartshorne, D.J.' 7 1 'Rayment, I.' 8 2 'Somlyo, A.V.' 9 2 'Matthew, J.D.' 10 2 'Wu, X.' 11 2 'Khromov, A.S.' 12 2 'Somlyo, A.P.' 13 3 'Wu, X.' 14 3 'Haystead, T.A.' 15 3 'Nakamoto, R.K.' 16 3 'Somlyo, A.V.' 17 3 'Somlyo, A.P.' 18 # _cell.entry_id 1FHG _cell.length_a 63.710 _cell.length_b 63.710 _cell.length_c 58.860 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1FHG _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat TELOKIN 16974.352 1 ? ? ? ? 2 water nat water 18.015 82 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ISGMSGRKASGSSPTSPINANKVENEDAFLEEVAEEKPHVKPYFTKTILDMEVVEGSAARFDCKVEGYPDPEVMWFKDDN PVKESRHFQIDYDEEGNCSLTISEVCGDDDAKYTCKAVNSLGEATCTAELLVETMGKEGEGEGEGEEDEEEEEE ; _entity_poly.pdbx_seq_one_letter_code_can ;ISGMSGRKASGSSPTSPINANKVENEDAFLEEVAEEKPHVKPYFTKTILDMEVVEGSAARFDCKVEGYPDPEVMWFKDDN PVKESRHFQIDYDEEGNCSLTISEVCGDDDAKYTCKAVNSLGEATCTAELLVETMGKEGEGEGEGEEDEEEEEE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 SER n 1 3 GLY n 1 4 MET n 1 5 SER n 1 6 GLY n 1 7 ARG n 1 8 LYS n 1 9 ALA n 1 10 SER n 1 11 GLY n 1 12 SER n 1 13 SER n 1 14 PRO n 1 15 THR n 1 16 SER n 1 17 PRO n 1 18 ILE n 1 19 ASN n 1 20 ALA n 1 21 ASN n 1 22 LYS n 1 23 VAL n 1 24 GLU n 1 25 ASN n 1 26 GLU n 1 27 ASP n 1 28 ALA n 1 29 PHE n 1 30 LEU n 1 31 GLU n 1 32 GLU n 1 33 VAL n 1 34 ALA n 1 35 GLU n 1 36 GLU n 1 37 LYS n 1 38 PRO n 1 39 HIS n 1 40 VAL n 1 41 LYS n 1 42 PRO n 1 43 TYR n 1 44 PHE n 1 45 THR n 1 46 LYS n 1 47 THR n 1 48 ILE n 1 49 LEU n 1 50 ASP n 1 51 MET n 1 52 GLU n 1 53 VAL n 1 54 VAL n 1 55 GLU n 1 56 GLY n 1 57 SER n 1 58 ALA n 1 59 ALA n 1 60 ARG n 1 61 PHE n 1 62 ASP n 1 63 CYS n 1 64 LYS n 1 65 VAL n 1 66 GLU n 1 67 GLY n 1 68 TYR n 1 69 PRO n 1 70 ASP n 1 71 PRO n 1 72 GLU n 1 73 VAL n 1 74 MET n 1 75 TRP n 1 76 PHE n 1 77 LYS n 1 78 ASP n 1 79 ASP n 1 80 ASN n 1 81 PRO n 1 82 VAL n 1 83 LYS n 1 84 GLU n 1 85 SER n 1 86 ARG n 1 87 HIS n 1 88 PHE n 1 89 GLN n 1 90 ILE n 1 91 ASP n 1 92 TYR n 1 93 ASP n 1 94 GLU n 1 95 GLU n 1 96 GLY n 1 97 ASN n 1 98 CYS n 1 99 SER n 1 100 LEU n 1 101 THR n 1 102 ILE n 1 103 SER n 1 104 GLU n 1 105 VAL n 1 106 CYS n 1 107 GLY n 1 108 ASP n 1 109 ASP n 1 110 ASP n 1 111 ALA n 1 112 LYS n 1 113 TYR n 1 114 THR n 1 115 CYS n 1 116 LYS n 1 117 ALA n 1 118 VAL n 1 119 ASN n 1 120 SER n 1 121 LEU n 1 122 GLY n 1 123 GLU n 1 124 ALA n 1 125 THR n 1 126 CYS n 1 127 THR n 1 128 ALA n 1 129 GLU n 1 130 LEU n 1 131 LEU n 1 132 VAL n 1 133 GLU n 1 134 THR n 1 135 MET n 1 136 GLY n 1 137 LYS n 1 138 GLU n 1 139 GLY n 1 140 GLU n 1 141 GLY n 1 142 GLU n 1 143 GLY n 1 144 GLU n 1 145 GLY n 1 146 GLU n 1 147 GLU n 1 148 ASP n 1 149 GLU n 1 150 GLU n 1 151 GLU n 1 152 GLU n 1 153 GLU n 1 154 GLU n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name turkey _entity_src_nat.pdbx_organism_scientific 'Meleagris gallopavo' _entity_src_nat.pdbx_ncbi_taxonomy_id 9103 _entity_src_nat.genus Meleagris _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue GIZZARD _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_code MYLK_MELGA _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P56276 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;ISGMSGRKASGSSPTSPINANKVENEDAFLEEVAEEKPHVKPYFTKTILDMDVVEGSAARFDCKVEGYPDPEVMWFKDDN PVKESRHFQIDYDEEGNCSLTISEVCGDDDAKYTCKAVNSLGEATCTAELLVETMGKEGEGEGEGEEDEEEEEE ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1FHG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 154 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P56276 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 154 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 154 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1FHG _struct_ref_seq_dif.mon_id GLU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 52 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P56276 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 52 _struct_ref_seq_dif.details 'SEE REMARK 999' _struct_ref_seq_dif.pdbx_auth_seq_num 52 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1FHG _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 30.0 _exptl_crystal.density_Matthews 2.03 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 4.0 _exptl_crystal_grow.temp 273.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details 'PEG6000, sodium acetate, pH 4.0, VAPOR DIFFUSION, SITTING DROP, temperature 273.0K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type ? _diffrn_detector.pdbx_collection_date 1997-09-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE BM14' _diffrn_source.pdbx_wavelength 1.0 _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline BM14 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1FHG _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 1.98 _reflns.number_obs 9904 _reflns.number_all 9904 _reflns.percent_possible_obs 99.6 _reflns.pdbx_Rmerge_I_obs 0.0700000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 35.7 _reflns.B_iso_Wilson_estimate 47.3 _reflns.pdbx_redundancy 10.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.98 _reflns_shell.d_res_low 2.05 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 99.6 _reflns_shell.Rmerge_I_obs 0.5740000 _reflns_shell.meanI_over_sigI_obs 2.34 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy 4.7 _reflns_shell.number_unique_all 967 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1FHG _refine.ls_number_reflns_obs 9598 _refine.ls_number_reflns_all 9598 _refine.pdbx_ls_sigma_I 0.0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 2.0 _refine.ls_percent_reflns_obs 99.5 _refine.ls_R_factor_obs 0.2330000 _refine.ls_R_factor_all 0.2330000 _refine.ls_R_factor_R_work 0.2100000 _refine.ls_R_factor_R_free 0.2660000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 506 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 42.95 _refine.aniso_B[1][1] -2.801 _refine.aniso_B[2][2] -2.801 _refine.aniso_B[3][3] 5.602 _refine.aniso_B[1][2] -4.624 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.solvent_model_details ? _refine.solvent_model_param_ksol 0.369 _refine.solvent_model_param_bsol 52.72 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 1tlk _refine.pdbx_method_to_determine_struct IR _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1FHG _refine_analyze.Luzzati_coordinate_error_obs 0.25 _refine_analyze.Luzzati_sigma_a_obs 0.20 _refine_analyze.Luzzati_d_res_low_obs 5.0 _refine_analyze.Luzzati_coordinate_error_free 0.33 _refine_analyze.Luzzati_sigma_a_free 0.22 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 814 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 82 _refine_hist.number_atoms_total 896 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.010 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.669 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 26.771 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.046 ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.68 1.5 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.69 2.0 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.58 2.0 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 4.05 2.5 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.R_factor_R_free 0.3020000 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2670000 _refine_ls_shell.d_res_high 2.00 _refine_ls_shell.d_res_low 2.07 _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.number_reflns_R_free 49 _refine_ls_shell.number_reflns_R_work 888 _refine_ls_shell.percent_reflns_R_free 5.0 _refine_ls_shell.percent_reflns_obs 99.79 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _pdbx_xplor_file.serial_no 1 _pdbx_xplor_file.param_file protein_rep.param _pdbx_xplor_file.topol_file protein.top _pdbx_xplor_file.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 1FHG _struct.title 'HIGH RESOLUTION REFINEMENT OF TELOKIN' _struct.pdbx_descriptor 'HIGH RESOLUTION REFINEMENT OF TELOKIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1FHG _struct_keywords.pdbx_keywords 'CONTRACTILE PROTEIN' _struct_keywords.text 'immunoglobulin fold, beta barrel, CONTRACTILE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 106 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 110 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 106 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 110 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TYR _struct_mon_prot_cis.label_seq_id 68 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TYR _struct_mon_prot_cis.auth_seq_id 68 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 69 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 69 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.23 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 40 ? LYS A 46 ? VAL A 40 LYS A 46 A 2 ALA A 59 ? TYR A 68 ? ALA A 59 TYR A 68 A 3 ASN A 97 ? ILE A 102 ? ASN A 97 ILE A 102 A 4 PHE A 88 ? TYR A 92 ? PHE A 88 TYR A 92 B 1 MET A 51 ? VAL A 54 ? MET A 51 VAL A 54 B 2 GLY A 122 ? GLU A 133 ? GLY A 122 GLU A 133 B 3 ALA A 111 ? ASN A 119 ? ALA A 111 ASN A 119 B 4 GLU A 72 ? LYS A 77 ? GLU A 72 LYS A 77 B 5 ASN A 80 ? PRO A 81 ? ASN A 80 PRO A 81 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 46 ? O LYS A 46 N LYS A 64 ? N LYS A 64 A 2 3 O CYS A 63 ? O CYS A 63 N CYS A 98 ? N CYS A 98 A 3 4 N THR A 101 ? N THR A 101 O GLN A 89 ? O GLN A 89 B 1 2 N MET A 51 ? N MET A 51 O GLU A 129 ? O GLU A 129 B 2 3 N LEU A 130 ? N LEU A 130 O ALA A 111 ? O ALA A 111 B 3 4 O VAL A 118 ? O VAL A 118 N GLU A 72 ? N GLU A 72 B 4 5 N LYS A 77 ? N LYS A 77 O ASN A 80 ? O ASN A 80 # _database_PDB_matrix.entry_id 1FHG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1FHG _atom_sites.fract_transf_matrix[1][1] 0.015696 _atom_sites.fract_transf_matrix[1][2] 0.009062 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018124 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016989 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 MET 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 GLY 6 6 ? ? ? A . n A 1 7 ARG 7 7 ? ? ? A . n A 1 8 LYS 8 8 ? ? ? A . n A 1 9 ALA 9 9 ? ? ? A . n A 1 10 SER 10 10 ? ? ? A . n A 1 11 GLY 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 SER 13 13 ? ? ? A . n A 1 14 PRO 14 14 ? ? ? A . n A 1 15 THR 15 15 ? ? ? A . n A 1 16 SER 16 16 ? ? ? A . n A 1 17 PRO 17 17 ? ? ? A . n A 1 18 ILE 18 18 ? ? ? A . n A 1 19 ASN 19 19 ? ? ? A . n A 1 20 ALA 20 20 ? ? ? A . n A 1 21 ASN 21 21 ? ? ? A . n A 1 22 LYS 22 22 ? ? ? A . n A 1 23 VAL 23 23 ? ? ? A . n A 1 24 GLU 24 24 ? ? ? A . n A 1 25 ASN 25 25 ? ? ? A . n A 1 26 GLU 26 26 ? ? ? A . n A 1 27 ASP 27 27 ? ? ? A . n A 1 28 ALA 28 28 ? ? ? A . n A 1 29 PHE 29 29 ? ? ? A . n A 1 30 LEU 30 30 ? ? ? A . n A 1 31 GLU 31 31 ? ? ? A . n A 1 32 GLU 32 32 ? ? ? A . n A 1 33 VAL 33 33 ? ? ? A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 MET 74 74 74 MET MET A . n A 1 75 TRP 75 75 75 TRP TRP A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 LYS 83 83 83 LYS ALA A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 CYS 98 98 98 CYS CYS A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 CYS 106 106 106 CYS CYS A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 CYS 115 115 115 CYS CYS A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 CYS 126 126 126 CYS CYS A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 MET 135 135 135 MET MET A . n A 1 136 GLY 136 136 ? ? ? A . n A 1 137 LYS 137 137 ? ? ? A . n A 1 138 GLU 138 138 ? ? ? A . n A 1 139 GLY 139 139 ? ? ? A . n A 1 140 GLU 140 140 ? ? ? A . n A 1 141 GLY 141 141 ? ? ? A . n A 1 142 GLU 142 142 ? ? ? A . n A 1 143 GLY 143 143 ? ? ? A . n A 1 144 GLU 144 144 ? ? ? A . n A 1 145 GLY 145 145 ? ? ? A . n A 1 146 GLU 146 146 ? ? ? A . n A 1 147 GLU 147 147 ? ? ? A . n A 1 148 ASP 148 148 ? ? ? A . n A 1 149 GLU 149 149 ? ? ? A . n A 1 150 GLU 150 150 ? ? ? A . n A 1 151 GLU 151 151 ? ? ? A . n A 1 152 GLU 152 152 ? ? ? A . n A 1 153 GLU 153 153 ? ? ? A . n A 1 154 GLU 154 154 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 277 ? B HOH . 2 1 A HOH 279 ? B HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-08-23 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement . ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 CNS phasing . ? 4 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 83 ? CG ? A LYS 83 CG 2 1 Y 1 A LYS 83 ? CD ? A LYS 83 CD 3 1 Y 1 A LYS 83 ? CE ? A LYS 83 CE 4 1 Y 1 A LYS 83 ? NZ ? A LYS 83 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ILE 1 ? A ILE 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A MET 4 ? A MET 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A GLY 6 ? A GLY 6 7 1 Y 1 A ARG 7 ? A ARG 7 8 1 Y 1 A LYS 8 ? A LYS 8 9 1 Y 1 A ALA 9 ? A ALA 9 10 1 Y 1 A SER 10 ? A SER 10 11 1 Y 1 A GLY 11 ? A GLY 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A SER 13 ? A SER 13 14 1 Y 1 A PRO 14 ? A PRO 14 15 1 Y 1 A THR 15 ? A THR 15 16 1 Y 1 A SER 16 ? A SER 16 17 1 Y 1 A PRO 17 ? A PRO 17 18 1 Y 1 A ILE 18 ? A ILE 18 19 1 Y 1 A ASN 19 ? A ASN 19 20 1 Y 1 A ALA 20 ? A ALA 20 21 1 Y 1 A ASN 21 ? A ASN 21 22 1 Y 1 A LYS 22 ? A LYS 22 23 1 Y 1 A VAL 23 ? A VAL 23 24 1 Y 1 A GLU 24 ? A GLU 24 25 1 Y 1 A ASN 25 ? A ASN 25 26 1 Y 1 A GLU 26 ? A GLU 26 27 1 Y 1 A ASP 27 ? A ASP 27 28 1 Y 1 A ALA 28 ? A ALA 28 29 1 Y 1 A PHE 29 ? A PHE 29 30 1 Y 1 A LEU 30 ? A LEU 30 31 1 Y 1 A GLU 31 ? A GLU 31 32 1 Y 1 A GLU 32 ? A GLU 32 33 1 Y 1 A VAL 33 ? A VAL 33 34 1 Y 1 A GLY 136 ? A GLY 136 35 1 Y 1 A LYS 137 ? A LYS 137 36 1 Y 1 A GLU 138 ? A GLU 138 37 1 Y 1 A GLY 139 ? A GLY 139 38 1 Y 1 A GLU 140 ? A GLU 140 39 1 Y 1 A GLY 141 ? A GLY 141 40 1 Y 1 A GLU 142 ? A GLU 142 41 1 Y 1 A GLY 143 ? A GLY 143 42 1 Y 1 A GLU 144 ? A GLU 144 43 1 Y 1 A GLY 145 ? A GLY 145 44 1 Y 1 A GLU 146 ? A GLU 146 45 1 Y 1 A GLU 147 ? A GLU 147 46 1 Y 1 A ASP 148 ? A ASP 148 47 1 Y 1 A GLU 149 ? A GLU 149 48 1 Y 1 A GLU 150 ? A GLU 150 49 1 Y 1 A GLU 151 ? A GLU 151 50 1 Y 1 A GLU 152 ? A GLU 152 51 1 Y 1 A GLU 153 ? A GLU 153 52 1 Y 1 A GLU 154 ? A GLU 154 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 201 HOH HOH A . B 2 HOH 2 202 202 HOH HOH A . B 2 HOH 3 203 203 HOH HOH A . B 2 HOH 4 204 204 HOH HOH A . B 2 HOH 5 205 205 HOH HOH A . B 2 HOH 6 206 206 HOH HOH A . B 2 HOH 7 207 207 HOH HOH A . B 2 HOH 8 208 208 HOH HOH A . B 2 HOH 9 209 209 HOH HOH A . B 2 HOH 10 210 210 HOH HOH A . B 2 HOH 11 211 211 HOH HOH A . B 2 HOH 12 212 212 HOH HOH A . B 2 HOH 13 213 213 HOH HOH A . B 2 HOH 14 214 214 HOH HOH A . B 2 HOH 15 215 215 HOH HOH A . B 2 HOH 16 216 216 HOH HOH A . B 2 HOH 17 217 217 HOH HOH A . B 2 HOH 18 218 218 HOH HOH A . B 2 HOH 19 219 219 HOH HOH A . B 2 HOH 20 220 220 HOH HOH A . B 2 HOH 21 221 221 HOH HOH A . B 2 HOH 22 222 222 HOH HOH A . B 2 HOH 23 223 223 HOH HOH A . B 2 HOH 24 224 224 HOH HOH A . B 2 HOH 25 225 225 HOH HOH A . B 2 HOH 26 226 226 HOH HOH A . B 2 HOH 27 227 227 HOH HOH A . B 2 HOH 28 228 228 HOH HOH A . B 2 HOH 29 229 229 HOH HOH A . B 2 HOH 30 230 230 HOH HOH A . B 2 HOH 31 231 231 HOH HOH A . B 2 HOH 32 232 232 HOH HOH A . B 2 HOH 33 233 233 HOH HOH A . B 2 HOH 34 234 234 HOH HOH A . B 2 HOH 35 235 235 HOH HOH A . B 2 HOH 36 236 236 HOH HOH A . B 2 HOH 37 237 237 HOH HOH A . B 2 HOH 38 238 238 HOH HOH A . B 2 HOH 39 239 239 HOH HOH A . B 2 HOH 40 240 240 HOH HOH A . B 2 HOH 41 241 241 HOH HOH A . B 2 HOH 42 242 242 HOH HOH A . B 2 HOH 43 243 243 HOH HOH A . B 2 HOH 44 244 244 HOH HOH A . B 2 HOH 45 245 245 HOH HOH A . B 2 HOH 46 246 246 HOH HOH A . B 2 HOH 47 247 247 HOH HOH A . B 2 HOH 48 248 248 HOH HOH A . B 2 HOH 49 249 249 HOH HOH A . B 2 HOH 50 250 250 HOH HOH A . B 2 HOH 51 251 251 HOH HOH A . B 2 HOH 52 252 252 HOH HOH A . B 2 HOH 53 253 253 HOH HOH A . B 2 HOH 54 254 254 HOH HOH A . B 2 HOH 55 255 255 HOH HOH A . B 2 HOH 56 256 256 HOH HOH A . B 2 HOH 57 257 257 HOH HOH A . B 2 HOH 58 258 258 HOH HOH A . B 2 HOH 59 259 259 HOH HOH A . B 2 HOH 60 260 260 HOH HOH A . B 2 HOH 61 261 261 HOH HOH A . B 2 HOH 62 262 262 HOH HOH A . B 2 HOH 63 263 263 HOH HOH A . B 2 HOH 64 264 264 HOH HOH A . B 2 HOH 65 265 265 HOH HOH A . B 2 HOH 66 266 266 HOH HOH A . B 2 HOH 67 267 267 HOH HOH A . B 2 HOH 68 268 268 HOH HOH A . B 2 HOH 69 269 269 HOH HOH A . B 2 HOH 70 270 270 HOH HOH A . B 2 HOH 71 271 271 HOH HOH A . B 2 HOH 72 272 272 HOH HOH A . B 2 HOH 73 273 273 HOH HOH A . B 2 HOH 74 274 274 HOH HOH A . B 2 HOH 75 275 275 HOH HOH A . B 2 HOH 76 276 276 HOH HOH A . B 2 HOH 77 277 277 HOH HOH A . B 2 HOH 78 278 278 HOH HOH A . B 2 HOH 79 279 279 HOH HOH A . B 2 HOH 80 280 280 HOH HOH A . B 2 HOH 81 281 281 HOH HOH A . B 2 HOH 82 282 282 HOH HOH A . #