data_1FI5 # _entry.id 1FI5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1FI5 pdb_00001fi5 10.2210/pdb1fi5/pdb RCSB RCSB011611 ? ? WWPDB D_1000011611 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.pdb_id 1FI5 _pdbx_database_PDB_obs_spr.replace_pdb_id 1GGS _pdbx_database_PDB_obs_spr.date 2000-08-23 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1FI5 _pdbx_database_status.recvd_initial_deposition_date 2000-08-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gasmi-Seabrook, G.M.' 1 'Howarth, J.W.' 2 'Finley, N.' 3 'Abusamhadneh, E.' 4 'Gaponenko, V.' 5 'Brito, R.M.' 6 'Solaro, R.J.' 7 'Rosevear, P.R.' 8 # _citation.id primary _citation.title 'Solution structures of the C-terminal domain of cardiac troponin C free and bound to the N-terminal domain of cardiac troponin I.' _citation.journal_abbrev Biochemistry _citation.journal_volume 38 _citation.page_first 8313 _citation.page_last 8322 _citation.year 1999 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10387077 _citation.pdbx_database_id_DOI 10.1021/bi9902642 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gasmi-Seabrook, G.M.' 1 ? primary 'Howarth, J.W.' 2 ? primary 'Finley, N.' 3 ? primary 'Abusamhadneh, E.' 4 ? primary 'Gaponenko, V.' 5 ? primary 'Brito, R.M.' 6 ? primary 'Solaro, R.J.' 7 ? primary 'Rosevear, P.R.' 8 ? # _cell.entry_id 1FI5 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1FI5 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PROTEIN (TROPONIN C)' 9463.531 1 ? ? 'RESIDUES 81 - 161' ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGV E ; _entity_poly.pdbx_seq_one_letter_code_can ;MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGV E ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 ARG n 1 4 CYS n 1 5 MET n 1 6 LYS n 1 7 ASP n 1 8 ASP n 1 9 SER n 1 10 LYS n 1 11 GLY n 1 12 LYS n 1 13 THR n 1 14 GLU n 1 15 GLU n 1 16 GLU n 1 17 LEU n 1 18 SER n 1 19 ASP n 1 20 LEU n 1 21 PHE n 1 22 ARG n 1 23 MET n 1 24 PHE n 1 25 ASP n 1 26 LYS n 1 27 ASN n 1 28 ALA n 1 29 ASP n 1 30 GLY n 1 31 TYR n 1 32 ILE n 1 33 ASP n 1 34 LEU n 1 35 GLU n 1 36 GLU n 1 37 LEU n 1 38 LYS n 1 39 ILE n 1 40 MET n 1 41 LEU n 1 42 GLN n 1 43 ALA n 1 44 THR n 1 45 GLY n 1 46 GLU n 1 47 THR n 1 48 ILE n 1 49 THR n 1 50 GLU n 1 51 ASP n 1 52 ASP n 1 53 ILE n 1 54 GLU n 1 55 GLU n 1 56 LEU n 1 57 MET n 1 58 LYS n 1 59 ASP n 1 60 GLY n 1 61 ASP n 1 62 LYS n 1 63 ASN n 1 64 ASN n 1 65 ASP n 1 66 GLY n 1 67 ARG n 1 68 ILE n 1 69 ASP n 1 70 TYR n 1 71 ASP n 1 72 GLU n 1 73 PHE n 1 74 LEU n 1 75 GLU n 1 76 PHE n 1 77 MET n 1 78 LYS n 1 79 GLY n 1 80 VAL n 1 81 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name chicken _entity_src_gen.gene_src_genus Gallus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue MUSCLE _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gallus gallus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9031 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ HEART _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell MYOCYTE _entity_src_gen.pdbx_gene_src_cellular_location 'THIN FILAMENT' _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene 'CTNC(81-161)' _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-23D+ _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ;C TERMINAL DOMAIN OF CARDIAC TROPONIN C (81- 161) BOUND TO THE N TERMINAL DOMAIN OF CARDIAC TROPONIN I (33-80), CALCIUM IONS BOUND AT SITES III AND IV ; # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TNNC1_CHICK _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P09860 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1FI5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 81 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P09860 _struct_ref_seq.db_align_beg 81 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 161 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 81 _struct_ref_seq.pdbx_auth_seq_align_end 161 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 15N-HSQC 1 2 1 '15N-NOESY- HSQC' 1 3 1 15N-TOCSY-HSQC 1 4 1 HNCO 1 5 1 HNCACB 1 6 1 '(HB)CBCA (CO)NNH' 1 7 1 'H(CCO)NH' 1 8 1 'C (CO)NH' 1 9 1 '(HB)CB(CGCD)HD' 1 10 1 '(HB)CB(CGCDCE)HE' 1 11 1 'CN- NOESY-HSQC' 1 12 1 HNHA 1 13 1 HNHB. 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 318.00 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.80 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM KCL,15mM CACL2, 100mM KCL,15mM CACL2' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1mM [15N,13C]cTnC(81-161)/cTnI(33-80); 20mM Tris-d11; 100mM KCl; 20mM DTT; 15mM CaCl2; 0.1mM Leupetin; 0.1mM pefabloc; 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA600 Varian 600 ? 2 INOVA800 Varian 800 ? # _pdbx_nmr_refine.entry_id 1FI5 _pdbx_nmr_refine.method DGSA _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1FI5 _pdbx_nmr_details.text ;BEST 20 STRUCTURES. THESE STRUCTURES WERE DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY ON CA2+_SATURATED 15N, 13C-CTNC(81-161) BOUND TO CTNI(33-80). ; # _pdbx_nmr_ensemble.entry_id 1FI5 _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'SMALLEST RMSD TO AVERAGE STRUCTURE' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1FI5 _pdbx_nmr_representative.conformer_id 5 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS 1.0 BRUNGER 1 'structure solution' CNS 1.0 BRUNGER 2 # _exptl.entry_id 1FI5 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1FI5 _struct.title 'NMR STRUCTURE OF THE C TERMINAL DOMAIN OF CARDIAC TROPONIN C BOUND TO THE N TERMINAL DOMAIN OF CARDIAC TROPONIN I.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1FI5 _struct_keywords.pdbx_keywords 'CONTRACTILE PROTEIN' _struct_keywords.text 'TROPONIN C-TROPONIN I INTERACTION, CARDIAC, MUSCLE PROTEIN, CALCIUM BINDING PROTEIN, CONTRACTILE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 E THR A 13 ? MET A 23 ? THR A 93 MET A 103 1 ? 11 HELX_P HELX_P2 F LEU A 34 ? ALA A 43 ? LEU A 114 ALA A 123 1 ? 10 HELX_P HELX_P3 G GLU A 50 ? ASP A 59 ? GLU A 130 ASP A 139 1 ? 10 HELX_P HELX_P4 H TYR A 70 ? LYS A 78 ? TYR A 150 LYS A 158 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 25 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 105 A CA 162 1_555 ? ? ? ? ? ? ? 2.429 ? ? metalc2 metalc ? ? A ASP 25 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 105 A CA 162 1_555 ? ? ? ? ? ? ? 2.196 ? ? metalc3 metalc ? ? A ASN 27 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 107 A CA 162 1_555 ? ? ? ? ? ? ? 3.125 ? ? metalc4 metalc ? ? A ASP 29 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 109 A CA 162 1_555 ? ? ? ? ? ? ? 2.013 ? ? metalc5 metalc ? ? A ASP 29 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 109 A CA 162 1_555 ? ? ? ? ? ? ? 2.842 ? ? metalc6 metalc ? ? A TYR 31 O ? ? ? 1_555 B CA . CA ? ? A TYR 111 A CA 162 1_555 ? ? ? ? ? ? ? 2.192 ? ? metalc7 metalc ? ? A GLU 36 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 116 A CA 162 1_555 ? ? ? ? ? ? ? 2.758 ? ? metalc8 metalc ? ? A GLU 36 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 116 A CA 162 1_555 ? ? ? ? ? ? ? 3.364 ? ? metalc9 metalc ? ? A ASP 61 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 141 A CA 163 1_555 ? ? ? ? ? ? ? 2.430 ? ? metalc10 metalc ? ? A ASN 63 N ? ? ? 1_555 C CA . CA ? ? A ASN 143 A CA 163 1_555 ? ? ? ? ? ? ? 2.870 ? ? metalc11 metalc ? ? A ASN 63 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 143 A CA 163 1_555 ? ? ? ? ? ? ? 3.169 ? ? metalc12 metalc ? ? A ASP 65 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 145 A CA 163 1_555 ? ? ? ? ? ? ? 1.924 ? ? metalc13 metalc ? ? A ARG 67 O ? ? ? 1_555 C CA . CA ? ? A ARG 147 A CA 163 1_555 ? ? ? ? ? ? ? 3.300 ? ? metalc14 metalc ? ? A GLU 72 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 152 A CA 163 1_555 ? ? ? ? ? ? ? 2.387 ? ? metalc15 metalc ? ? A GLU 72 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 152 A CA 163 1_555 ? ? ? ? ? ? ? 2.062 ? ? hydrog1 hydrog ? ? A ILE 32 H ? ? ? 1_555 A ILE 68 O ? ? A ILE 112 A ILE 148 1_555 ? ? ? ? ? ? ? ? ? ? hydrog2 hydrog ? ? A ILE 68 H ? ? ? 1_555 A ILE 32 O ? ? A ILE 148 A ILE 112 1_555 ? ? ? ? ? ? ? ? ? ? hydrog3 hydrog ? ? A GLY 30 H ? ? ? 1_555 A ASP 25 OD1 ? ? A GLY 110 A ASP 105 1_555 ? ? ? ? ? ? ? ? ? ? hydrog4 hydrog ? ? A GLY 66 H ? ? ? 1_555 A ASP 61 OD1 ? ? A GLY 146 A ASP 141 1_555 ? ? ? ? ? ? ? ? ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? hydrog ? ? # _struct_sheet.id S _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id S _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S 1 TYR A 31 ? ASP A 33 ? TYR A 111 ASP A 113 S 2 ARG A 67 ? ASP A 69 ? ARG A 147 ASP A 149 # _pdbx_struct_sheet_hbond.sheet_id S _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 32 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 112 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 68 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 148 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 162 ? 5 'BINDING SITE FOR RESIDUE CA A 162' AC2 Software A CA 163 ? 5 'BINDING SITE FOR RESIDUE CA A 163' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 25 ? ASP A 105 . ? 1_555 ? 2 AC1 5 ASN A 27 ? ASN A 107 . ? 1_555 ? 3 AC1 5 ASP A 29 ? ASP A 109 . ? 1_555 ? 4 AC1 5 TYR A 31 ? TYR A 111 . ? 1_555 ? 5 AC1 5 GLU A 36 ? GLU A 116 . ? 1_555 ? 6 AC2 5 ASP A 61 ? ASP A 141 . ? 1_555 ? 7 AC2 5 ASN A 63 ? ASN A 143 . ? 1_555 ? 8 AC2 5 ASP A 65 ? ASP A 145 . ? 1_555 ? 9 AC2 5 ARG A 67 ? ARG A 147 . ? 1_555 ? 10 AC2 5 GLU A 72 ? GLU A 152 . ? 1_555 ? # _database_PDB_matrix.entry_id 1FI5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1FI5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 81 81 MET MET A . n A 1 2 VAL 2 82 82 VAL VAL A . n A 1 3 ARG 3 83 83 ARG ARG A . n A 1 4 CYS 4 84 84 CYS CYS A . n A 1 5 MET 5 85 85 MET MET A . n A 1 6 LYS 6 86 86 LYS LYS A . n A 1 7 ASP 7 87 87 ASP ASP A . n A 1 8 ASP 8 88 88 ASP ASP A . n A 1 9 SER 9 89 89 SER SER A . n A 1 10 LYS 10 90 90 LYS LYS A . n A 1 11 GLY 11 91 91 GLY GLY A . n A 1 12 LYS 12 92 92 LYS LYS A . n A 1 13 THR 13 93 93 THR THR A . n A 1 14 GLU 14 94 94 GLU GLU A . n A 1 15 GLU 15 95 95 GLU GLU A . n A 1 16 GLU 16 96 96 GLU GLU A . n A 1 17 LEU 17 97 97 LEU LEU A . n A 1 18 SER 18 98 98 SER SER A . n A 1 19 ASP 19 99 99 ASP ASP A . n A 1 20 LEU 20 100 100 LEU LEU A . n A 1 21 PHE 21 101 101 PHE PHE A . n A 1 22 ARG 22 102 102 ARG ARG A . n A 1 23 MET 23 103 103 MET MET A . n A 1 24 PHE 24 104 104 PHE PHE A . n A 1 25 ASP 25 105 105 ASP ASP A . n A 1 26 LYS 26 106 106 LYS LYS A . n A 1 27 ASN 27 107 107 ASN ASN A . n A 1 28 ALA 28 108 108 ALA ALA A . n A 1 29 ASP 29 109 109 ASP ASP A . n A 1 30 GLY 30 110 110 GLY GLY A . n A 1 31 TYR 31 111 111 TYR TYR A . n A 1 32 ILE 32 112 112 ILE ILE A . n A 1 33 ASP 33 113 113 ASP ASP A . n A 1 34 LEU 34 114 114 LEU LEU A . n A 1 35 GLU 35 115 115 GLU GLU A . n A 1 36 GLU 36 116 116 GLU GLU A . n A 1 37 LEU 37 117 117 LEU LEU A . n A 1 38 LYS 38 118 118 LYS LYS A . n A 1 39 ILE 39 119 119 ILE ILE A . n A 1 40 MET 40 120 120 MET MET A . n A 1 41 LEU 41 121 121 LEU LEU A . n A 1 42 GLN 42 122 122 GLN GLN A . n A 1 43 ALA 43 123 123 ALA ALA A . n A 1 44 THR 44 124 124 THR THR A . n A 1 45 GLY 45 125 125 GLY GLY A . n A 1 46 GLU 46 126 126 GLU GLU A . n A 1 47 THR 47 127 127 THR THR A . n A 1 48 ILE 48 128 128 ILE ILE A . n A 1 49 THR 49 129 129 THR THR A . n A 1 50 GLU 50 130 130 GLU GLU A . n A 1 51 ASP 51 131 131 ASP ASP A . n A 1 52 ASP 52 132 132 ASP ASP A . n A 1 53 ILE 53 133 133 ILE ILE A . n A 1 54 GLU 54 134 134 GLU GLU A . n A 1 55 GLU 55 135 135 GLU GLU A . n A 1 56 LEU 56 136 136 LEU LEU A . n A 1 57 MET 57 137 137 MET MET A . n A 1 58 LYS 58 138 138 LYS LYS A . n A 1 59 ASP 59 139 139 ASP ASP A . n A 1 60 GLY 60 140 140 GLY GLY A . n A 1 61 ASP 61 141 141 ASP ASP A . n A 1 62 LYS 62 142 142 LYS LYS A . n A 1 63 ASN 63 143 143 ASN ASN A . n A 1 64 ASN 64 144 144 ASN ASN A . n A 1 65 ASP 65 145 145 ASP ASP A . n A 1 66 GLY 66 146 146 GLY GLY A . n A 1 67 ARG 67 147 147 ARG ARG A . n A 1 68 ILE 68 148 148 ILE ILE A . n A 1 69 ASP 69 149 149 ASP ASP A . n A 1 70 TYR 70 150 150 TYR TYR A . n A 1 71 ASP 71 151 151 ASP ASP A . n A 1 72 GLU 72 152 152 GLU GLU A . n A 1 73 PHE 73 153 153 PHE PHE A . n A 1 74 LEU 74 154 154 LEU LEU A . n A 1 75 GLU 75 155 155 GLU GLU A . n A 1 76 PHE 76 156 156 PHE PHE A . n A 1 77 MET 77 157 157 MET MET A . n A 1 78 LYS 78 158 158 LYS LYS A . n A 1 79 GLY 79 159 159 GLY GLY A . n A 1 80 VAL 80 160 160 VAL VAL A . n A 1 81 GLU 81 161 161 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 162 162 CA CA A . C 2 CA 1 163 163 CA CA A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD2 ? A ASP 25 ? A ASP 105 ? 1_555 56.5 ? 2 OD1 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD1 ? A ASN 27 ? A ASN 107 ? 1_555 129.7 ? 3 OD2 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD1 ? A ASN 27 ? A ASN 107 ? 1_555 75.3 ? 4 OD1 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD1 ? A ASP 29 ? A ASP 109 ? 1_555 106.2 ? 5 OD2 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD1 ? A ASP 29 ? A ASP 109 ? 1_555 86.9 ? 6 OD1 ? A ASN 27 ? A ASN 107 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD1 ? A ASP 29 ? A ASP 109 ? 1_555 82.8 ? 7 OD1 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD2 ? A ASP 29 ? A ASP 109 ? 1_555 156.2 ? 8 OD2 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD2 ? A ASP 29 ? A ASP 109 ? 1_555 118.0 ? 9 OD1 ? A ASN 27 ? A ASN 107 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD2 ? A ASP 29 ? A ASP 109 ? 1_555 59.1 ? 10 OD1 ? A ASP 29 ? A ASP 109 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD2 ? A ASP 29 ? A ASP 109 ? 1_555 50.3 ? 11 OD1 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 O ? A TYR 31 ? A TYR 111 ? 1_555 69.0 ? 12 OD2 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 O ? A TYR 31 ? A TYR 111 ? 1_555 118.5 ? 13 OD1 ? A ASN 27 ? A ASN 107 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 O ? A TYR 31 ? A TYR 111 ? 1_555 159.2 ? 14 OD1 ? A ASP 29 ? A ASP 109 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 O ? A TYR 31 ? A TYR 111 ? 1_555 82.6 ? 15 OD2 ? A ASP 29 ? A ASP 109 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 O ? A TYR 31 ? A TYR 111 ? 1_555 100.1 ? 16 OD1 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE2 ? A GLU 36 ? A GLU 116 ? 1_555 129.2 ? 17 OD2 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE2 ? A GLU 36 ? A GLU 116 ? 1_555 116.2 ? 18 OD1 ? A ASN 27 ? A ASN 107 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE2 ? A GLU 36 ? A GLU 116 ? 1_555 58.9 ? 19 OD1 ? A ASP 29 ? A ASP 109 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE2 ? A GLU 36 ? A GLU 116 ? 1_555 124.2 ? 20 OD2 ? A ASP 29 ? A ASP 109 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE2 ? A GLU 36 ? A GLU 116 ? 1_555 74.6 ? 21 O ? A TYR 31 ? A TYR 111 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE2 ? A GLU 36 ? A GLU 116 ? 1_555 119.5 ? 22 OD1 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE1 ? A GLU 36 ? A GLU 116 ? 1_555 117.6 ? 23 OD2 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE1 ? A GLU 36 ? A GLU 116 ? 1_555 149.8 ? 24 OD1 ? A ASN 27 ? A ASN 107 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE1 ? A GLU 36 ? A GLU 116 ? 1_555 96.2 ? 25 OD1 ? A ASP 29 ? A ASP 109 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE1 ? A GLU 36 ? A GLU 116 ? 1_555 121.3 ? 26 OD2 ? A ASP 29 ? A ASP 109 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE1 ? A GLU 36 ? A GLU 116 ? 1_555 79.0 ? 27 O ? A TYR 31 ? A TYR 111 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE1 ? A GLU 36 ? A GLU 116 ? 1_555 78.9 ? 28 OE2 ? A GLU 36 ? A GLU 116 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE1 ? A GLU 36 ? A GLU 116 ? 1_555 40.6 ? 29 OD1 ? A ASP 61 ? A ASP 141 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 N ? A ASN 63 ? A ASN 143 ? 1_555 65.0 ? 30 OD1 ? A ASP 61 ? A ASP 141 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OD1 ? A ASN 63 ? A ASN 143 ? 1_555 133.5 ? 31 N ? A ASN 63 ? A ASN 143 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OD1 ? A ASN 63 ? A ASN 143 ? 1_555 71.0 ? 32 OD1 ? A ASP 61 ? A ASP 141 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OD1 ? A ASP 65 ? A ASP 145 ? 1_555 84.2 ? 33 N ? A ASN 63 ? A ASN 143 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OD1 ? A ASP 65 ? A ASP 145 ? 1_555 127.3 ? 34 OD1 ? A ASN 63 ? A ASN 143 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OD1 ? A ASP 65 ? A ASP 145 ? 1_555 136.9 ? 35 OD1 ? A ASP 61 ? A ASP 141 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 O ? A ARG 67 ? A ARG 147 ? 1_555 83.5 ? 36 N ? A ASN 63 ? A ASN 143 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 O ? A ARG 67 ? A ARG 147 ? 1_555 145.3 ? 37 OD1 ? A ASN 63 ? A ASN 143 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 O ? A ARG 67 ? A ARG 147 ? 1_555 131.7 ? 38 OD1 ? A ASP 65 ? A ASP 145 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 O ? A ARG 67 ? A ARG 147 ? 1_555 58.6 ? 39 OD1 ? A ASP 61 ? A ASP 141 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OE1 ? A GLU 72 ? A GLU 152 ? 1_555 76.9 ? 40 N ? A ASN 63 ? A ASN 143 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OE1 ? A GLU 72 ? A GLU 152 ? 1_555 100.1 ? 41 OD1 ? A ASN 63 ? A ASN 143 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OE1 ? A GLU 72 ? A GLU 152 ? 1_555 97.3 ? 42 OD1 ? A ASP 65 ? A ASP 145 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OE1 ? A GLU 72 ? A GLU 152 ? 1_555 113.8 ? 43 O ? A ARG 67 ? A ARG 147 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OE1 ? A GLU 72 ? A GLU 152 ? 1_555 56.6 ? 44 OD1 ? A ASP 61 ? A ASP 141 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OE2 ? A GLU 72 ? A GLU 152 ? 1_555 129.3 ? 45 N ? A ASN 63 ? A ASN 143 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OE2 ? A GLU 72 ? A GLU 152 ? 1_555 140.6 ? 46 OD1 ? A ASN 63 ? A ASN 143 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OE2 ? A GLU 72 ? A GLU 152 ? 1_555 78.9 ? 47 OD1 ? A ASP 65 ? A ASP 145 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OE2 ? A GLU 72 ? A GLU 152 ? 1_555 92.1 ? 48 O ? A ARG 67 ? A ARG 147 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OE2 ? A GLU 72 ? A GLU 152 ? 1_555 53.0 ? 49 OE1 ? A GLU 72 ? A GLU 152 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OE2 ? A GLU 72 ? A GLU 152 ? 1_555 58.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-08-23 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.value' 14 4 'Structure model' '_struct_conn.pdbx_dist_value' 15 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 16 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 17 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 27 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 28 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 29 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 HB2 A ASN 143 ? ? CA A CA 163 ? ? 1.58 2 9 HB2 A ASN 143 ? ? CA A CA 163 ? ? 1.51 3 12 HB2 A ASN 143 ? ? CA A CA 163 ? ? 1.51 4 18 HG2 A GLU 152 ? ? CA A CA 163 ? ? 1.52 5 19 HB3 A ASN 107 ? ? CA A CA 162 ? ? 1.51 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 84 ? ? -93.04 -68.88 2 1 LYS A 86 ? ? 60.43 79.21 3 1 SER A 89 ? ? -69.08 71.00 4 1 LYS A 90 ? ? -109.89 55.67 5 1 ALA A 108 ? ? 63.78 64.02 6 2 VAL A 82 ? ? -178.07 135.43 7 2 ARG A 83 ? ? 60.51 97.39 8 3 LYS A 86 ? ? 63.79 -79.19 9 3 LYS A 90 ? ? -97.25 39.75 10 3 THR A 124 ? ? -58.93 174.29 11 3 THR A 127 ? ? -106.07 48.50 12 4 MET A 85 ? ? 63.04 144.72 13 4 SER A 89 ? ? -98.92 30.29 14 5 VAL A 82 ? ? -161.73 -44.77 15 5 ARG A 83 ? ? -69.08 -173.84 16 5 CYS A 84 ? ? 61.16 -171.37 17 5 MET A 85 ? ? 64.60 -78.77 18 6 ASP A 88 ? ? -73.83 -167.58 19 6 SER A 89 ? ? -91.48 50.33 20 6 THR A 93 ? ? -99.95 -85.06 21 6 ALA A 108 ? ? 67.73 75.33 22 6 ASN A 144 ? ? 66.81 71.87 23 7 CYS A 84 ? ? -149.70 -48.98 24 7 LYS A 86 ? ? -105.07 78.50 25 7 ASP A 87 ? ? -92.80 -65.65 26 7 ALA A 108 ? ? 67.82 72.36 27 7 THR A 127 ? ? -102.81 77.55 28 7 VAL A 160 ? ? -102.11 74.34 29 8 CYS A 84 ? ? -156.06 -62.96 30 8 ASP A 87 ? ? -96.40 42.08 31 9 VAL A 82 ? ? -171.09 59.97 32 9 ASP A 87 ? ? -58.91 -179.38 33 9 ALA A 108 ? ? 64.27 74.90 34 9 THR A 124 ? ? -59.84 179.10 35 10 ARG A 83 ? ? 60.10 88.58 36 10 MET A 85 ? ? -140.15 41.11 37 10 LYS A 86 ? ? -98.23 30.28 38 10 ASP A 88 ? ? -101.42 77.39 39 10 LYS A 90 ? ? -97.11 39.89 40 10 THR A 93 ? ? -100.72 -74.96 41 10 ASN A 144 ? ? 66.11 60.22 42 10 VAL A 160 ? ? -94.93 43.38 43 11 VAL A 82 ? ? -151.15 -53.79 44 11 ARG A 83 ? ? 60.60 -169.11 45 11 LYS A 86 ? ? -172.92 -41.18 46 11 ASP A 87 ? ? -97.66 36.61 47 11 LYS A 92 ? ? -98.04 49.88 48 11 ALA A 108 ? ? 62.86 68.29 49 11 THR A 127 ? ? -102.99 72.33 50 12 MET A 85 ? ? 60.29 -179.01 51 12 ASP A 88 ? ? -93.27 50.69 52 12 SER A 89 ? ? -98.43 34.50 53 12 LYS A 90 ? ? -116.81 78.58 54 12 LYS A 92 ? ? -104.39 67.08 55 12 ALA A 108 ? ? 65.14 63.49 56 12 THR A 124 ? ? -58.80 179.90 57 13 ARG A 83 ? ? -95.78 41.41 58 13 CYS A 84 ? ? -145.44 -49.38 59 13 LYS A 86 ? ? -68.53 94.43 60 14 MET A 85 ? ? 62.73 -79.96 61 14 SER A 89 ? ? -59.56 -172.20 62 14 THR A 93 ? ? -100.31 -163.39 63 15 ARG A 83 ? ? 53.69 -173.99 64 15 SER A 89 ? ? -96.06 37.70 65 15 LYS A 106 ? ? -101.16 -62.02 66 15 THR A 124 ? ? -59.94 172.04 67 15 ASN A 144 ? ? 62.35 61.73 68 16 VAL A 82 ? ? 60.03 96.88 69 16 CYS A 84 ? ? -163.03 108.30 70 16 ASN A 144 ? ? 68.04 69.40 71 17 MET A 85 ? ? -169.20 -44.74 72 18 LYS A 86 ? ? -151.41 31.31 73 18 ASP A 87 ? ? -92.16 -64.85 74 18 VAL A 160 ? ? -97.15 35.94 75 19 VAL A 82 ? ? -173.58 -43.56 76 19 CYS A 84 ? ? 63.28 174.21 77 19 LYS A 92 ? ? -59.85 87.16 78 19 ASN A 144 ? ? 67.14 65.92 79 20 VAL A 82 ? ? 69.14 -67.52 80 20 MET A 85 ? ? -162.64 30.90 81 20 ASP A 88 ? ? -95.36 40.92 82 20 LYS A 92 ? ? -69.79 99.85 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA #