data_1FJK # _entry.id 1FJK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1FJK RCSB RCSB011643 WWPDB D_1000011643 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1FJP _pdbx_database_related.details 'NMR Solution Structure of Phospholamban, 10 STRUCTURES' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1FJK _pdbx_database_status.recvd_initial_deposition_date 2000-08-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lamberth, S.' 1 'Griesinger, C.' 2 'Schmid, H.' 3 'Carafoli, E.' 4 'Muenchbach, M.' 5 'Vorherr, T.' 6 'Krebs, J.' 7 # _citation.id primary _citation.title 'NMR Solution Structure of Phospholamban' _citation.journal_abbrev HELV.CHIM.ACTA _citation.journal_volume 83 _citation.page_first 2141 _citation.page_last 2152 _citation.year 2000 _citation.journal_id_ASTM HCACAV _citation.country SZ _citation.journal_id_ISSN 0018-019X _citation.journal_id_CSD 0010 _citation.book_publisher ? _citation.pdbx_database_id_PubMed -1 _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Lamberth, S.' 1 primary 'Schmid, H.' 2 primary 'Muenchbach, M.' 3 primary 'Vorherr, T.' 4 primary 'Krebs, J.' 5 primary 'Carafoli, E.' 6 primary 'Griesinger, C.' 7 # _cell.entry_id 1FJK _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1FJK _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'CARDIAC PHOSPHOLAMBAN' _entity.formula_weight 6129.504 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation C41F _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MDKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILIFLLLICIIVMLL _entity_poly.pdbx_seq_one_letter_code_can MDKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILIFLLLICIIVMLL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 LYS n 1 4 VAL n 1 5 GLN n 1 6 TYR n 1 7 LEU n 1 8 THR n 1 9 ARG n 1 10 SER n 1 11 ALA n 1 12 ILE n 1 13 ARG n 1 14 ARG n 1 15 ALA n 1 16 SER n 1 17 THR n 1 18 ILE n 1 19 GLU n 1 20 MET n 1 21 PRO n 1 22 GLN n 1 23 GLN n 1 24 ALA n 1 25 ARG n 1 26 GLN n 1 27 ASN n 1 28 LEU n 1 29 GLN n 1 30 ASN n 1 31 LEU n 1 32 PHE n 1 33 ILE n 1 34 ASN n 1 35 PHE n 1 36 CYS n 1 37 LEU n 1 38 ILE n 1 39 LEU n 1 40 ILE n 1 41 PHE n 1 42 LEU n 1 43 LEU n 1 44 LEU n 1 45 ILE n 1 46 CYS n 1 47 ILE n 1 48 ILE n 1 49 VAL n 1 50 MET n 1 51 LEU n 1 52 LEU n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name pig _entity_src_nat.pdbx_organism_scientific 'Sus scrofa' _entity_src_nat.pdbx_ncbi_taxonomy_id 9823 _entity_src_nat.genus Sus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_code PPLA_PIG _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P61013 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code MDKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1FJK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 52 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P61013 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 52 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 52 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1FJK _struct_ref_seq_dif.mon_id PHE _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 41 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P61013 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 41 _struct_ref_seq_dif.details ENGINEERED _struct_ref_seq_dif.pdbx_auth_seq_num 41 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 DQF-COSY 3 1 1 TOCSY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM Phospholamban (C41F)' _pdbx_nmr_sample_details.solvent_system '50 % CDCl3, 50 % CD3OH' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 800 2 ? Bruker DRX 600 # _pdbx_nmr_refine.entry_id 1FJK _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics' _pdbx_nmr_refine.details 'the structure is based on a total of 649 restraints, 644 are NOE-derived distance constraints, 5 dihedral angle restraints' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1FJK _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques.' # _pdbx_nmr_ensemble.entry_id 1FJK _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'minimized average structure' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1FJK _pdbx_nmr_representative.conformer_id 21 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal FELIX 98 'data analysis' MSI 1 X-PLOR 98.1 'structure solution' Brunger 2 UXNMR 2.6 collection Bruker 3 X-PLOR 98.1 refinement Brunger 4 # _exptl.entry_id 1FJK _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1FJK _struct.title 'NMR Solution Structure of Phospholamban (C41F)' _struct.pdbx_descriptor 'CARDIAC PHOSPHOLAMBAN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1FJK _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'Helix, MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 3 ? THR A 17 ? LYS A 3 THR A 17 1 ? 15 HELX_P HELX_P2 2 MET A 20 ? MET A 50 ? MET A 20 MET A 50 1 ? 31 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1FJK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1FJK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LEU 52 52 52 LEU LEU A . n # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-09-06 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -164.55 -39.83 2 1 ALA A 15 ? ? -145.82 -40.01 3 1 MET A 20 ? ? -144.28 55.49 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 9 ? ? 0.316 'SIDE CHAIN' 2 1 ARG A 13 ? ? 0.287 'SIDE CHAIN' 3 1 ARG A 14 ? ? 0.286 'SIDE CHAIN' 4 1 ARG A 25 ? ? 0.318 'SIDE CHAIN' #