data_1FN0 # _entry.id 1FN0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1FN0 pdb_00001fn0 10.2210/pdb1fn0/pdb RCSB RCSB011727 ? ? WWPDB D_1000011727 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1FMZ '1FMZ contains the same protein.' unspecified PDB 1EYL '1EYL is the same protein in recombinant form' unspecified PDB 4WBC '4WBC is the crystal structure of the same protein (native) at 2.13A resolution' unspecified PDB 2WBC '2WBC is the crystal structure of the same protein (native) at 2.3A resolution' unspecified PDB 1WBC '1WBC is the Crystal structure of the same protein (native) at 2.95A resolution' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1FN0 _pdbx_database_status.recvd_initial_deposition_date 2000-08-19 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dattagupta, J.K.' 1 'Chakrabarti, C.' 2 'Ravichandran, S.' 3 'Dasgupta, J.' 4 'Ghosh, S.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;The role of Asn14 in the stability and conformation of the reactive-site loop of winged bean chymotrypsin inhibitor: crystal structures of two point mutants Asn14-->Lys and Asn14-->Asp. ; 'PROTEIN ENG.' 14 349 357 2001 PRENE9 UK 0269-2139 0859 ? 11438758 10.1093/protein/14.5.349 1 ;Crystallography of a Kunitz-type Serine Protease Inhibitor: The 90K Structure of Winged bean Chymotrypsin Inhibitor (WCI) at 2.13A resolution. ; 'Acta Crystallogr.,Sect.D' 55 1814 1821 1999 ABCRE6 DK 0907-4449 0766 ? ? 10.1107/S0907444999009877 2 ;Refined crystal structure (2.3A) of a double-headed Winged bean alpha-Chymotrypsin Inhibitor and location of its second reactive site ; Proteins 35 321 331 1999 PSFGEY US 0887-3585 0867 ? ? '10.1002/(SICI)1097-0134(19990515)35:3<321::AID-PROT6>3.3.CO;2-P' 3 ;cDNA cloning, expression and rapid purification of Kunitz-type Winged bean Chymotrypsin Inhibitor ; 'Protein Expr.Purif.' 10 100 106 1997 PEXPEJ US 1046-5928 0757 ? ? 10.1006/prep.1996.0707 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ravichandran, S.' 1 ? primary 'Dasgupta, J.' 2 ? primary 'Chakrabarti, C.' 3 ? primary 'Ghosh, S.' 4 ? primary 'Singh, M.' 5 ? primary 'Dattagupta, J.K.' 6 ? 1 'Ravichandran, S.' 7 ? 1 'Sen, U.' 8 ? 1 'Chakrabarti, C.' 9 ? 1 'Dattagupta, J.K.' 10 ? 2 'Dattagupta, J.K.' 11 ? 2 'Podder, A.' 12 ? 2 'Chakrabarti, C.' 13 ? 2 'Sen, U.' 14 ? 2 'Mukhopadhyay, D.' 15 ? 2 'Dutta, S.K.' 16 ? 2 'Singh, M.' 17 ? 3 'Dattagupta, J.K.' 18 ? 3 'Chakrabarti, C.' 19 ? 3 'Ravichandran, S.' 20 ? 3 'Dasgupta, J.' 21 ? 3 'Ghosh, S.' 22 ? # _cell.entry_id 1FN0 _cell.length_a 61.240 _cell.length_b 61.240 _cell.length_c 210.860 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1FN0 _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CHYMOTRYPSIN INHIBITOR 3' 20675.316 1 ? N14D ? ? 2 non-polymer syn 'SULFATE ION' 96.063 4 ? ? ? ? 3 water nat water 18.015 169 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name WCI-3 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEFDDDLVDAEGNLVEDGGTYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSQFLSLFIPRGSLVAL GFANPPSCAASPWWTVVDSPQGPAVKLSQQKLPEKDILVFKFEKVSHSNIHVYKLLYCQHDEEDVKCDQYIGIHRDRNGN RRLVVTEENPLELVLLKAKSETASSH ; _entity_poly.pdbx_seq_one_letter_code_can ;MEFDDDLVDAEGNLVEDGGTYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSQFLSLFIPRGSLVAL GFANPPSCAASPWWTVVDSPQGPAVKLSQQKLPEKDILVFKFEKVSHSNIHVYKLLYCQHDEEDVKCDQYIGIHRDRNGN RRLVVTEENPLELVLLKAKSETASSH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 PHE n 1 4 ASP n 1 5 ASP n 1 6 ASP n 1 7 LEU n 1 8 VAL n 1 9 ASP n 1 10 ALA n 1 11 GLU n 1 12 GLY n 1 13 ASN n 1 14 LEU n 1 15 VAL n 1 16 GLU n 1 17 ASP n 1 18 GLY n 1 19 GLY n 1 20 THR n 1 21 TYR n 1 22 TYR n 1 23 LEU n 1 24 LEU n 1 25 PRO n 1 26 HIS n 1 27 ILE n 1 28 TRP n 1 29 ALA n 1 30 HIS n 1 31 GLY n 1 32 GLY n 1 33 GLY n 1 34 ILE n 1 35 GLU n 1 36 THR n 1 37 ALA n 1 38 LYS n 1 39 THR n 1 40 GLY n 1 41 ASN n 1 42 GLU n 1 43 PRO n 1 44 CYS n 1 45 PRO n 1 46 LEU n 1 47 THR n 1 48 VAL n 1 49 VAL n 1 50 ARG n 1 51 SER n 1 52 PRO n 1 53 ASN n 1 54 GLU n 1 55 VAL n 1 56 SER n 1 57 LYS n 1 58 GLY n 1 59 GLU n 1 60 PRO n 1 61 ILE n 1 62 ARG n 1 63 ILE n 1 64 SER n 1 65 SER n 1 66 GLN n 1 67 PHE n 1 68 LEU n 1 69 SER n 1 70 LEU n 1 71 PHE n 1 72 ILE n 1 73 PRO n 1 74 ARG n 1 75 GLY n 1 76 SER n 1 77 LEU n 1 78 VAL n 1 79 ALA n 1 80 LEU n 1 81 GLY n 1 82 PHE n 1 83 ALA n 1 84 ASN n 1 85 PRO n 1 86 PRO n 1 87 SER n 1 88 CYS n 1 89 ALA n 1 90 ALA n 1 91 SER n 1 92 PRO n 1 93 TRP n 1 94 TRP n 1 95 THR n 1 96 VAL n 1 97 VAL n 1 98 ASP n 1 99 SER n 1 100 PRO n 1 101 GLN n 1 102 GLY n 1 103 PRO n 1 104 ALA n 1 105 VAL n 1 106 LYS n 1 107 LEU n 1 108 SER n 1 109 GLN n 1 110 GLN n 1 111 LYS n 1 112 LEU n 1 113 PRO n 1 114 GLU n 1 115 LYS n 1 116 ASP n 1 117 ILE n 1 118 LEU n 1 119 VAL n 1 120 PHE n 1 121 LYS n 1 122 PHE n 1 123 GLU n 1 124 LYS n 1 125 VAL n 1 126 SER n 1 127 HIS n 1 128 SER n 1 129 ASN n 1 130 ILE n 1 131 HIS n 1 132 VAL n 1 133 TYR n 1 134 LYS n 1 135 LEU n 1 136 LEU n 1 137 TYR n 1 138 CYS n 1 139 GLN n 1 140 HIS n 1 141 ASP n 1 142 GLU n 1 143 GLU n 1 144 ASP n 1 145 VAL n 1 146 LYS n 1 147 CYS n 1 148 ASP n 1 149 GLN n 1 150 TYR n 1 151 ILE n 1 152 GLY n 1 153 ILE n 1 154 HIS n 1 155 ARG n 1 156 ASP n 1 157 ARG n 1 158 ASN n 1 159 GLY n 1 160 ASN n 1 161 ARG n 1 162 ARG n 1 163 LEU n 1 164 VAL n 1 165 VAL n 1 166 THR n 1 167 GLU n 1 168 GLU n 1 169 ASN n 1 170 PRO n 1 171 LEU n 1 172 GLU n 1 173 LEU n 1 174 VAL n 1 175 LEU n 1 176 LEU n 1 177 LYS n 1 178 ALA n 1 179 LYS n 1 180 SER n 1 181 GLU n 1 182 THR n 1 183 ALA n 1 184 SER n 1 185 SER n 1 186 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'winged bean' _entity_src_gen.gene_src_genus Psophocarpus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Psophocarpus tetragonolobus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3891 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ SEED _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PTRC99A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_code ICW3_PSOTE _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P10822 _struct_ref.pdbx_align_begin 25 _struct_ref.pdbx_seq_one_letter_code ;DDDLVDAEGNLVENGGTYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSQFLSLFIPRGSLVALGFA NPPSCAASPWWTVVDSPQGPAVKLSQQKLPEKDILVFKFEKVSHSNIHVYKLLYCQHDEEDVKCDQYIGIHRDRNGNRRL VVTEENPLELVLLKAKSETASSHETASSH ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1FN0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 186 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P10822 _struct_ref_seq.db_align_beg 25 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 207 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 186 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1FN0 MET A 1 ? UNP P10822 ? ? 'cloning artifact' 1 1 1 1FN0 GLU A 2 ? UNP P10822 ? ? 'cloning artifact' 2 2 1 1FN0 PHE A 3 ? UNP P10822 ? ? 'cloning artifact' 3 3 1 1FN0 ASP A 17 ? UNP P10822 ASN 38 'engineered mutation' 17 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1FN0 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 55.41 _exptl_crystal.density_Matthews 2.76 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 5.4 _exptl_crystal_grow.temp 277.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details 'Ammonium sulfate, Sodium acetate, pH 5.4, VAPOR DIFFUSION, HANGING DROP, temperature 277.0K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1998-08-10 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.934 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-4' _diffrn_source.pdbx_wavelength 0.934 _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-4 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1FN0 _reflns.observed_criterion_sigma_I 3.0 _reflns.observed_criterion_sigma_F 3.0 _reflns.d_resolution_low 18.0 _reflns.d_resolution_high 1.9 _reflns.number_obs 14503 _reflns.number_all 33037 _reflns.percent_possible_obs 75.7 _reflns.pdbx_Rmerge_I_obs 0.087 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 3.5 _reflns.B_iso_Wilson_estimate 31.4 _reflns.pdbx_redundancy 2.0 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.9 _reflns_shell.d_res_low 2.00 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 75.7 _reflns_shell.Rmerge_I_obs 0.423 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy 2.0 _reflns_shell.number_unique_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1FN0 _refine.ls_number_reflns_obs 11351 _refine.ls_number_reflns_all 33037 _refine.pdbx_ls_sigma_I 0.0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 10.0 _refine.ls_d_res_high 2.00 _refine.ls_percent_reflns_obs 76.1 _refine.ls_R_factor_obs 0.217 _refine.ls_R_factor_all 0.217 _refine.ls_R_factor_R_work 0.209 _refine.ls_R_factor_R_free 0.287 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 1249 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1384 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 169 _refine_hist.number_atoms_total 1573 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 10.0 # _struct.entry_id 1FN0 _struct.title 'STRUCTURE OF A MUTANT WINGED BEAN CHYMOTRYPSIN INHIBITOR PROTEIN, N14D.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1FN0 _struct_keywords.pdbx_keywords 'HYDROLASE INHIBITOR' _struct_keywords.text 'Beta Trefoil, HYDROLASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # _struct_biol.id 1 _struct_biol.details 'The biological assembly is a monomer' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 27 ? GLY A 31 ? ILE A 27 GLY A 31 5 ? 5 HELX_P HELX_P2 2 PRO A 113 ? LEU A 118 ? PRO A 113 LEU A 118 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 44 SG ? ? ? 1_555 A CYS 88 SG ? ? A CYS 44 A CYS 88 1_555 ? ? ? ? ? ? ? 2.001 ? ? disulf2 disulf ? ? A CYS 138 SG ? ? ? 1_555 A CYS 147 SG ? ? A CYS 138 A CYS 147 1_555 ? ? ? ? ? ? ? 2.048 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 11 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel A 9 10 ? anti-parallel A 10 11 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 34 ? ALA A 37 ? ILE A 34 ALA A 37 A 2 THR A 47 ? ARG A 50 ? THR A 47 ARG A 50 A 3 ARG A 161 ? THR A 166 ? ARG A 161 THR A 166 A 4 ASP A 144 ? ARG A 155 ? ASP A 144 ARG A 155 A 5 TYR A 133 ? ASP A 141 ? TYR A 133 ASP A 141 A 6 PHE A 120 ? LYS A 124 ? PHE A 120 LYS A 124 A 7 VAL A 78 ? PHE A 82 ? VAL A 78 PHE A 82 A 8 ILE A 61 ? SER A 65 ? ILE A 61 SER A 65 A 9 THR A 20 ? PRO A 25 ? THR A 20 PRO A 25 A 10 GLU A 172 ? LYS A 177 ? GLU A 172 LYS A 177 A 11 TYR A 133 ? ASP A 141 ? TYR A 133 ASP A 141 B 1 THR A 95 ? VAL A 97 ? THR A 95 VAL A 97 B 2 ALA A 104 ? LYS A 106 ? ALA A 104 LYS A 106 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ALA A 37 ? O ALA A 37 N THR A 47 ? N THR A 47 A 2 3 N ARG A 50 ? N ARG A 50 O ARG A 161 ? O ARG A 161 A 3 4 N THR A 166 ? N THR A 166 O TYR A 150 ? O TYR A 150 A 4 5 N ILE A 151 ? N ILE A 151 O LEU A 135 ? O LEU A 135 A 5 6 N LEU A 136 ? N LEU A 136 O LYS A 121 ? O LYS A 121 A 6 7 O PHE A 120 ? O PHE A 120 N VAL A 78 ? N VAL A 78 A 7 8 O GLY A 81 ? O GLY A 81 N ARG A 62 ? N ARG A 62 A 8 9 O ILE A 61 ? O ILE A 61 N TYR A 21 ? N TYR A 21 A 9 10 N LEU A 24 ? N LEU A 24 O VAL A 174 ? O VAL A 174 A 10 11 N LEU A 173 ? N LEU A 173 O TYR A 133 ? O TYR A 133 B 1 2 N VAL A 97 ? N VAL A 97 O ALA A 104 ? O ALA A 104 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 900 ? 3 'BINDING SITE FOR RESIDUE SO4 A 900' AC2 Software A SO4 902 ? 8 'BINDING SITE FOR RESIDUE SO4 A 902' AC3 Software A SO4 904 ? 5 'BINDING SITE FOR RESIDUE SO4 A 904' AC4 Software A SO4 905 ? 4 'BINDING SITE FOR RESIDUE SO4 A 905' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 HIS A 26 ? HIS A 26 . ? 1_555 ? 2 AC1 3 HIS A 26 ? HIS A 26 . ? 12_545 ? 3 AC1 3 ASN A 129 ? ASN A 129 . ? 1_555 ? 4 AC2 8 PRO A 25 ? PRO A 25 . ? 1_555 ? 5 AC2 8 HIS A 26 ? HIS A 26 . ? 1_555 ? 6 AC2 8 ILE A 27 ? ILE A 27 . ? 1_555 ? 7 AC2 8 HIS A 30 ? HIS A 30 . ? 1_555 ? 8 AC2 8 ARG A 50 ? ARG A 50 . ? 1_555 ? 9 AC2 8 HIS A 127 ? HIS A 127 . ? 12_545 ? 10 AC2 8 GLU A 172 ? GLU A 172 . ? 1_555 ? 11 AC2 8 HOH F . ? HOH A 331 . ? 1_555 ? 12 AC3 5 SER A 69 ? SER A 69 . ? 1_555 ? 13 AC3 5 LEU A 70 ? LEU A 70 . ? 1_555 ? 14 AC3 5 TRP A 93 ? TRP A 93 . ? 8_435 ? 15 AC3 5 LYS A 111 ? LYS A 111 . ? 8_435 ? 16 AC3 5 HOH F . ? HOH A 246 . ? 1_555 ? 17 AC4 4 HIS A 30 ? HIS A 30 . ? 12_545 ? 18 AC4 4 SER A 126 ? SER A 126 . ? 1_555 ? 19 AC4 4 HIS A 127 ? HIS A 127 . ? 1_555 ? 20 AC4 4 HOH F . ? HOH A 268 . ? 1_555 ? # _database_PDB_matrix.entry_id 1FN0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1FN0 _atom_sites.fract_transf_matrix[1][1] 0.01633 _atom_sites.fract_transf_matrix[1][2] 0.00943 _atom_sites.fract_transf_matrix[1][3] 0.00000 _atom_sites.fract_transf_matrix[2][1] 0.00000 _atom_sites.fract_transf_matrix[2][2] 0.01886 _atom_sites.fract_transf_matrix[2][3] 0.00000 _atom_sites.fract_transf_matrix[3][1] 0.00000 _atom_sites.fract_transf_matrix[3][2] 0.00000 _atom_sites.fract_transf_matrix[3][3] 0.00474 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 PHE 3 3 ? ? ? A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 TRP 93 93 93 TRP TRP A . n A 1 94 TRP 94 94 94 TRP TRP A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 PHE 122 122 122 PHE PHE A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 CYS 138 138 138 CYS CYS A . n A 1 139 GLN 139 139 139 GLN GLN A . n A 1 140 HIS 140 140 140 HIS HIS A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 CYS 147 147 147 CYS CYS A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 HIS 154 154 154 HIS HIS A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 ASN 158 158 158 ASN ASN A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 ASN 160 160 160 ASN ASN A . n A 1 161 ARG 161 161 161 ARG ARG A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 THR 166 166 166 THR THR A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 ASN 169 169 169 ASN ASN A . n A 1 170 PRO 170 170 170 PRO PRO A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 GLU 181 181 ? ? ? A . n A 1 182 THR 182 182 ? ? ? A . n A 1 183 ALA 183 183 ? ? ? A . n A 1 184 SER 184 184 ? ? ? A . n A 1 185 SER 185 185 ? ? ? A . n A 1 186 HIS 186 186 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 900 900 SO4 SUL A . C 2 SO4 1 902 902 SO4 SUL A . D 2 SO4 1 904 904 SO4 SUL A . E 2 SO4 1 905 905 SO4 SUL A . F 3 HOH 1 201 201 HOH HOH A . F 3 HOH 2 202 202 HOH HOH A . F 3 HOH 3 203 203 HOH HOH A . F 3 HOH 4 204 204 HOH HOH A . F 3 HOH 5 205 205 HOH HOH A . F 3 HOH 6 206 206 HOH HOH A . F 3 HOH 7 207 207 HOH HOH A . F 3 HOH 8 208 208 HOH HOH A . F 3 HOH 9 209 209 HOH HOH A . F 3 HOH 10 210 210 HOH HOH A . F 3 HOH 11 211 211 HOH HOH A . F 3 HOH 12 212 212 HOH HOH A . F 3 HOH 13 213 213 HOH HOH A . F 3 HOH 14 214 214 HOH HOH A . F 3 HOH 15 215 215 HOH HOH A . F 3 HOH 16 216 216 HOH HOH A . F 3 HOH 17 217 217 HOH HOH A . F 3 HOH 18 218 218 HOH HOH A . F 3 HOH 19 219 219 HOH HOH A . F 3 HOH 20 220 220 HOH HOH A . F 3 HOH 21 221 221 HOH HOH A . F 3 HOH 22 222 222 HOH HOH A . F 3 HOH 23 223 223 HOH HOH A . F 3 HOH 24 224 224 HOH HOH A . F 3 HOH 25 225 225 HOH HOH A . F 3 HOH 26 226 226 HOH HOH A . F 3 HOH 27 227 227 HOH HOH A . F 3 HOH 28 228 228 HOH HOH A . F 3 HOH 29 229 229 HOH HOH A . F 3 HOH 30 230 230 HOH HOH A . F 3 HOH 31 231 231 HOH HOH A . F 3 HOH 32 232 232 HOH HOH A . F 3 HOH 33 234 234 HOH HOH A . F 3 HOH 34 235 235 HOH HOH A . F 3 HOH 35 236 236 HOH HOH A . F 3 HOH 36 237 237 HOH HOH A . F 3 HOH 37 238 238 HOH HOH A . F 3 HOH 38 239 239 HOH HOH A . F 3 HOH 39 240 240 HOH HOH A . F 3 HOH 40 241 241 HOH HOH A . F 3 HOH 41 242 242 HOH HOH A . F 3 HOH 42 243 243 HOH HOH A . F 3 HOH 43 244 244 HOH HOH A . F 3 HOH 44 245 245 HOH HOH A . F 3 HOH 45 246 246 HOH HOH A . F 3 HOH 46 247 247 HOH HOH A . F 3 HOH 47 248 248 HOH HOH A . F 3 HOH 48 249 249 HOH HOH A . F 3 HOH 49 250 250 HOH HOH A . F 3 HOH 50 251 251 HOH HOH A . F 3 HOH 51 253 253 HOH HOH A . F 3 HOH 52 254 254 HOH HOH A . F 3 HOH 53 255 255 HOH HOH A . F 3 HOH 54 256 256 HOH HOH A . F 3 HOH 55 257 257 HOH HOH A . F 3 HOH 56 258 258 HOH HOH A . F 3 HOH 57 259 259 HOH HOH A . F 3 HOH 58 260 260 HOH HOH A . F 3 HOH 59 261 261 HOH HOH A . F 3 HOH 60 262 262 HOH HOH A . F 3 HOH 61 263 263 HOH HOH A . F 3 HOH 62 264 264 HOH HOH A . F 3 HOH 63 265 265 HOH HOH A . F 3 HOH 64 266 266 HOH HOH A . F 3 HOH 65 267 267 HOH HOH A . F 3 HOH 66 268 268 HOH HOH A . F 3 HOH 67 269 269 HOH HOH A . F 3 HOH 68 270 270 HOH HOH A . F 3 HOH 69 271 271 HOH HOH A . F 3 HOH 70 272 272 HOH HOH A . F 3 HOH 71 273 273 HOH HOH A . F 3 HOH 72 274 274 HOH HOH A . F 3 HOH 73 275 275 HOH HOH A . F 3 HOH 74 276 276 HOH HOH A . F 3 HOH 75 277 277 HOH HOH A . F 3 HOH 76 278 278 HOH HOH A . F 3 HOH 77 279 279 HOH HOH A . F 3 HOH 78 280 280 HOH HOH A . F 3 HOH 79 281 281 HOH HOH A . F 3 HOH 80 282 282 HOH HOH A . F 3 HOH 81 283 283 HOH HOH A . F 3 HOH 82 284 284 HOH HOH A . F 3 HOH 83 285 285 HOH HOH A . F 3 HOH 84 286 286 HOH HOH A . F 3 HOH 85 287 287 HOH HOH A . F 3 HOH 86 288 288 HOH HOH A . F 3 HOH 87 289 289 HOH HOH A . F 3 HOH 88 290 290 HOH HOH A . F 3 HOH 89 291 291 HOH HOH A . F 3 HOH 90 292 292 HOH HOH A . F 3 HOH 91 293 293 HOH HOH A . F 3 HOH 92 294 294 HOH HOH A . F 3 HOH 93 295 295 HOH HOH A . F 3 HOH 94 297 297 HOH HOH A . F 3 HOH 95 298 298 HOH HOH A . F 3 HOH 96 299 299 HOH HOH A . F 3 HOH 97 300 300 HOH HOH A . F 3 HOH 98 301 301 HOH HOH A . F 3 HOH 99 302 302 HOH HOH A . F 3 HOH 100 303 303 HOH HOH A . F 3 HOH 101 304 304 HOH HOH A . F 3 HOH 102 305 305 HOH HOH A . F 3 HOH 103 306 306 HOH HOH A . F 3 HOH 104 307 307 HOH HOH A . F 3 HOH 105 308 308 HOH HOH A . F 3 HOH 106 309 309 HOH HOH A . F 3 HOH 107 310 310 HOH HOH A . F 3 HOH 108 312 312 HOH HOH A . F 3 HOH 109 313 313 HOH HOH A . F 3 HOH 110 314 314 HOH HOH A . F 3 HOH 111 315 315 HOH HOH A . F 3 HOH 112 316 316 HOH HOH A . F 3 HOH 113 317 317 HOH HOH A . F 3 HOH 114 318 318 HOH HOH A . F 3 HOH 115 320 320 HOH HOH A . F 3 HOH 116 322 322 HOH HOH A . F 3 HOH 117 323 323 HOH HOH A . F 3 HOH 118 324 324 HOH HOH A . F 3 HOH 119 325 325 HOH HOH A . F 3 HOH 120 326 326 HOH HOH A . F 3 HOH 121 327 327 HOH HOH A . F 3 HOH 122 328 328 HOH HOH A . F 3 HOH 123 329 329 HOH HOH A . F 3 HOH 124 330 330 HOH HOH A . F 3 HOH 125 331 331 HOH HOH A . F 3 HOH 126 333 333 HOH HOH A . F 3 HOH 127 336 336 HOH HOH A . F 3 HOH 128 337 337 HOH HOH A . F 3 HOH 129 338 338 HOH HOH A . F 3 HOH 130 339 339 HOH HOH A . F 3 HOH 131 342 342 HOH HOH A . F 3 HOH 132 343 343 HOH HOH A . F 3 HOH 133 344 344 HOH HOH A . F 3 HOH 134 345 345 HOH HOH A . F 3 HOH 135 346 346 HOH HOH A . F 3 HOH 136 347 347 HOH HOH A . F 3 HOH 137 348 348 HOH HOH A . F 3 HOH 138 350 350 HOH HOH A . F 3 HOH 139 351 351 HOH HOH A . F 3 HOH 140 352 352 HOH HOH A . F 3 HOH 141 355 355 HOH HOH A . F 3 HOH 142 356 356 HOH HOH A . F 3 HOH 143 357 357 HOH HOH A . F 3 HOH 144 358 358 HOH HOH A . F 3 HOH 145 359 359 HOH HOH A . F 3 HOH 146 360 360 HOH HOH A . F 3 HOH 147 361 361 HOH HOH A . F 3 HOH 148 362 362 HOH HOH A . F 3 HOH 149 363 363 HOH HOH A . F 3 HOH 150 365 365 HOH HOH A . F 3 HOH 151 366 366 HOH HOH A . F 3 HOH 152 369 369 HOH HOH A . F 3 HOH 153 371 371 HOH HOH A . F 3 HOH 154 372 372 HOH HOH A . F 3 HOH 155 373 373 HOH HOH A . F 3 HOH 156 374 374 HOH HOH A . F 3 HOH 157 376 376 HOH HOH A . F 3 HOH 158 377 377 HOH HOH A . F 3 HOH 159 378 378 HOH HOH A . F 3 HOH 160 379 379 HOH HOH A . F 3 HOH 161 380 380 HOH HOH A . F 3 HOH 162 381 381 HOH HOH A . F 3 HOH 163 382 382 HOH HOH A . F 3 HOH 164 383 383 HOH HOH A . F 3 HOH 165 384 384 HOH HOH A . F 3 HOH 166 385 385 HOH HOH A . F 3 HOH 167 386 386 HOH HOH A . F 3 HOH 168 387 387 HOH HOH A . F 3 HOH 169 501 501 HOH HOH A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 3 software_defined_assembly PISA,PQS dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F 2 1,2 A,B,C,D,E,F 3 1,3 A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 2680 ? 2 MORE -141 ? 2 'SSA (A^2)' 18500 ? 3 'ABSA (A^2)' 2310 ? 3 MORE -99 ? 3 'SSA (A^2)' 18490 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_545 x,x-y-1,-z+1/6 0.5000000000 0.8660254038 0.0000000000 30.6200000000 0.8660254038 -0.5000000000 0.0000000000 -53.0353957278 0.0000000000 0.0000000000 -1.0000000000 35.1433333333 3 'crystal symmetry operation' 8_435 x-y-1,-y-2,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -106.0707914555 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A SO4 900 ? B SO4 . 2 1 A HOH 501 ? F HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-02-19 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' struct_ref_seq_dif 3 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MOSFLM 'data reduction' . ? 1 SCALA 'data scaling' . ? 2 REFMAC refinement . ? 3 CCP4 'data scaling' '(SCALA)' ? 4 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 VAL _pdbx_validate_rmsd_bond.auth_seq_id_1 174 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CG1 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 VAL _pdbx_validate_rmsd_bond.auth_seq_id_2 174 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.655 _pdbx_validate_rmsd_bond.bond_target_value 1.524 _pdbx_validate_rmsd_bond.bond_deviation 0.131 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.021 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 17 ? ? CG A ASP 17 ? ? OD2 A ASP 17 ? ? 124.81 118.30 6.51 0.90 N 2 1 CB A ASP 98 ? ? CG A ASP 98 ? ? OD2 A ASP 98 ? ? 124.39 118.30 6.09 0.90 N 3 1 CB A ASP 116 ? ? CG A ASP 116 ? ? OD2 A ASP 116 ? ? 125.96 118.30 7.66 0.90 N 4 1 CB A ASP 144 ? ? CG A ASP 144 ? ? OD2 A ASP 144 ? ? 124.03 118.30 5.73 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 68 ? ? -88.27 33.82 2 1 GLU A 142 ? ? 63.03 -2.86 3 1 GLU A 143 ? ? -169.69 -44.13 4 1 ASP A 144 ? ? -106.52 -126.90 5 1 VAL A 145 ? ? -171.27 143.70 6 1 ARG A 157 ? ? -56.12 -2.06 7 1 GLU A 168 ? ? -93.85 -85.99 8 1 LYS A 179 ? ? -43.95 152.22 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A PHE 3 ? A PHE 3 4 1 Y 1 A GLU 181 ? A GLU 181 5 1 Y 1 A THR 182 ? A THR 182 6 1 Y 1 A ALA 183 ? A ALA 183 7 1 Y 1 A SER 184 ? A SER 184 8 1 Y 1 A SER 185 ? A SER 185 9 1 Y 1 A HIS 186 ? A HIS 186 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH #