data_1FOW # _entry.id 1FOW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1FOW pdb_00001fow 10.2210/pdb1fow/pdb WWPDB D_1000173358 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1FOX _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1FOW _pdbx_database_status.recvd_initial_deposition_date 1996-09-13 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Markus, M.A.' 1 'Hinck, A.P.' 2 'Huang, S.' 3 'Draper, D.E.' 4 'Torchia, D.A.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;High resolution solution structure of ribosomal protein L11-C76, a helical protein with a flexible loop that becomes structured upon binding to RNA. ; Nat.Struct.Biol. 4 70 77 1997 NSBIEW US 1072-8368 2024 ? 8989327 10.1038/nsb0197-70 1 'The RNA Binding Domain of Ribosomal Protein L11 is Structurally Similar to Homeodomains' Nat.Struct.Biol. 4 24 ? 1997 NSBIEW US 1072-8368 2024 ? ? ? 2 'Cooperative Interactions of RNA and Thiostrepton Antibiotic with Two Domains of Ribosomal Protein L11' Biochemistry 35 1581 ? 1996 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Markus, M.A.' 1 ? primary 'Hinck, A.P.' 2 ? primary 'Huang, S.' 3 ? primary 'Draper, D.E.' 4 ? primary 'Torchia, D.A.' 5 ? 1 'Xing, Y.' 6 ? 1 'Guha Thakurta, D.' 7 ? 1 'Draper, D.E.' 8 ? 2 'Xing, Y.' 9 ? 2 'Draper, D.E.' 10 ? # _cell.entry_id 1FOW _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1FOW _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description L11-C76 _entity.formula_weight 8152.554 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'INS(MET1)' _entity.pdbx_fragment 'CARBOXYL-TERMINAL DOMAIN OF PROTEIN L11, RESIDUES THR 59 TO ASP 133' _entity.details 'BINDS SPECIFICALLY TO RNA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVVED _entity_poly.pdbx_seq_one_letter_code_can MTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVVED _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 PHE n 1 4 ILE n 1 5 THR n 1 6 LYS n 1 7 THR n 1 8 PRO n 1 9 PRO n 1 10 ALA n 1 11 ALA n 1 12 VAL n 1 13 LEU n 1 14 LEU n 1 15 LYS n 1 16 LYS n 1 17 ALA n 1 18 ALA n 1 19 GLY n 1 20 ILE n 1 21 GLU n 1 22 SER n 1 23 GLY n 1 24 SER n 1 25 GLY n 1 26 GLU n 1 27 PRO n 1 28 ASN n 1 29 ARG n 1 30 ASN n 1 31 LYS n 1 32 VAL n 1 33 ALA n 1 34 THR n 1 35 ILE n 1 36 LYS n 1 37 ARG n 1 38 ASP n 1 39 LYS n 1 40 VAL n 1 41 ARG n 1 42 GLU n 1 43 ILE n 1 44 ALA n 1 45 GLU n 1 46 LEU n 1 47 LYS n 1 48 MET n 1 49 PRO n 1 50 ASP n 1 51 LEU n 1 52 ASN n 1 53 ALA n 1 54 ALA n 1 55 SER n 1 56 ILE n 1 57 GLU n 1 58 ALA n 1 59 ALA n 1 60 MET n 1 61 ARG n 1 62 MET n 1 63 ILE n 1 64 GLU n 1 65 GLY n 1 66 THR n 1 67 ALA n 1 68 ARG n 1 69 SER n 1 70 MET n 1 71 GLY n 1 72 ILE n 1 73 VAL n 1 74 VAL n 1 75 GLU n 1 76 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Geobacillus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Geobacillus stearothermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1422 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'DERIVED FROM PET11A' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RL11_BACST _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P56210 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MKLQIPAGKANPAPPVGPALGQAGVNIMAFCKEFNARTADQAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKAAGIESG SGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVVED ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1FOW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 76 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P56210 _struct_ref_seq.db_align_beg 59 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 133 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 76 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '15N HSQC' 1 2 1 '13C HSQC' 1 3 1 HNCACB 1 4 1 'CBCA(CO)NH' 1 5 1 HCACO 1 6 1 'C(CO)NH' 1 7 1 'H(CCO)NH' 1 8 1 HCCH-TOCSY 1 9 1 HMBC 1 10 1 HNHA 1 11 1 HNHB 1 12 1 HCACB-COSY 1 13 1 '(13CO)SED CT HSQC' 1 14 1 '(15N) SED CT HSQC' 1 15 1 '(13C-13C) LRC' 1 16 1 '(13C-1H) LRC' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.10 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 AMX Bruker 500 2 DMX Bruker 500 # _pdbx_nmr_refine.entry_id 1FOW _pdbx_nmr_refine.method DGSA _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1FOW _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'NO NOE VIOLATIONS OVER 0.3 A, NO ANGLE VIOLATIONS OVER 5 DEG' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' X-PLOR ? ? 2 # _exptl.entry_id 1FOW _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1FOW _struct.title 'NMR STRUCTURE OF L11-C76, THE C-TERMINAL DOMAIN OF 50S RIBOSOMAL PROTEIN L11, MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1FOW _struct_keywords.pdbx_keywords 'RIBOSOMAL PROTEIN' _struct_keywords.text 'RIBOSOMAL PROTEIN, RNA-BINDING DOMAIN, L11-C76, ALPHA-HELICAL PROTEIN, HOMEODOMAIN FOLD' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 A1 ALA A 10 ? ALA A 18 ? ALA A 10 ALA A 18 1 ? 9 HELX_P HELX_P2 A2 ARG A 37 ? LEU A 46 ? ARG A 37 LEU A 46 1 ? 10 HELX_P HELX_P3 A3 ILE A 56 ? THR A 66 ? ILE A 56 THR A 66 1 'CSI RANGE: GLU 57 TO SER 69' 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role hydrog1 hydrog ? ? A VAL 40 N ? ? ? 1_555 A LYS 36 O ? ? A VAL 40 A LYS 36 1_555 ? ? ? ? ? ? ? ? ? ? hydrog2 hydrog ? ? A ARG 41 N ? ? ? 1_555 A ARG 37 O ? ? A ARG 41 A ARG 37 1_555 ? ? ? ? ? ? ? ? ? ? hydrog3 hydrog ? ? A ILE 43 N ? ? ? 1_555 A LYS 39 O ? ? A ILE 43 A LYS 39 1_555 ? ? ? ? ? ? ? ? ? ? hydrog4 hydrog ? ? A ALA 44 N ? ? ? 1_555 A VAL 40 O ? ? A ALA 44 A VAL 40 1_555 ? ? ? ? ? ? ? ? ? ? hydrog5 hydrog ? ? A GLU 45 N ? ? ? 1_555 A ARG 41 O ? ? A GLU 45 A ARG 41 1_555 ? ? ? ? ? ? ? ? ? ? hydrog6 hydrog ? ? A LEU 46 N ? ? ? 1_555 A GLU 42 O ? ? A LEU 46 A GLU 42 1_555 ? ? ? ? ? ? ? ? ? ? hydrog7 hydrog ? ? A LYS 47 N ? ? ? 1_555 A ILE 43 O ? ? A LYS 47 A ILE 43 1_555 ? ? ? ? ? ? ? ? ? ? hydrog8 hydrog ? ? A ALA 59 N ? ? ? 1_555 A SER 55 O ? ? A ALA 59 A SER 55 1_555 ? ? ? ? ? ? ? ? ? ? hydrog9 hydrog ? ? A MET 60 N ? ? ? 1_555 A ILE 56 O ? ? A MET 60 A ILE 56 1_555 ? ? ? ? ? ? ? ? ? ? hydrog10 hydrog ? ? A ILE 63 N ? ? ? 1_555 A ALA 59 O ? ? A ILE 63 A ALA 59 1_555 ? ? ? ? ? ? ? ? ? ? hydrog11 hydrog ? ? A GLU 64 N ? ? ? 1_555 A MET 60 O ? ? A GLU 64 A MET 60 1_555 ? ? ? ? ? ? ? ? ? ? hydrog12 hydrog ? ? A ALA 67 N ? ? ? 1_555 A ILE 63 O ? ? A ALA 67 A ILE 63 1_555 ? ? ? ? ? ? ? ? ? ? hydrog13 hydrog ? ? A ILE 35 N ? ? ? 1_555 A VAL 73 O ? ? A ILE 35 A VAL 73 1_555 ? ? ? ? ? ? ? ? ? ? hydrog14 hydrog ? ? A VAL 73 N ? ? ? 1_555 A ALA 33 O ? ? A VAL 73 A ALA 33 1_555 ? ? ? ? ? ? ? ? ? ? hydrog15 hydrog ? ? A GLU 75 N ? ? ? 1_555 A ILE 35 O ? ? A GLU 75 A ILE 35 1_555 ? ? ? ? ? ? ? ? ? ? # _struct_conn_type.id hydrog _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id B1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id B1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id B1 1 THR A 34 ? LYS A 36 ? THR A 34 LYS A 36 B1 2 VAL A 73 ? GLU A 75 ? VAL A 73 GLU A 75 # _pdbx_struct_sheet_hbond.sheet_id B1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 35 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 35 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 73 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 73 # _database_PDB_matrix.entry_id 1FOW _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1FOW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ASP 76 76 76 ASP ASP A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-03-12 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 2 ? ? 77.50 -163.43 2 1 PHE A 3 ? ? -93.49 52.49 3 1 ILE A 4 ? ? -155.69 -143.64 4 1 THR A 5 ? ? 86.49 -31.10 5 1 LYS A 6 ? ? -91.83 41.02 6 1 THR A 7 ? ? -41.16 150.28 7 1 ILE A 20 ? ? -113.24 56.24 8 1 GLU A 21 ? ? -85.82 44.95 9 1 SER A 22 ? ? 61.62 60.24 10 1 SER A 24 ? ? 176.81 -31.07 11 1 PRO A 27 ? ? -80.85 42.61 12 1 ASN A 28 ? ? -42.92 -92.25 13 1 ASN A 30 ? ? 57.58 -167.33 14 1 LYS A 31 ? ? 70.12 86.80 15 1 ALA A 33 ? ? 47.56 83.24 16 1 LYS A 36 ? ? -45.17 164.16 17 1 ASN A 52 ? ? 73.73 35.83 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 29 ? ? 0.273 'SIDE CHAIN' 2 1 ARG A 37 ? ? 0.313 'SIDE CHAIN' 3 1 ARG A 41 ? ? 0.263 'SIDE CHAIN' 4 1 ARG A 61 ? ? 0.234 'SIDE CHAIN' 5 1 ARG A 68 ? ? 0.297 'SIDE CHAIN' #