data_1FU9 # _entry.id 1FU9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1FU9 pdb_00001fu9 10.2210/pdb1fu9/pdb RCSB RCSB011907 ? ? WWPDB D_1000011907 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-10-04 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 28 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 29 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 30 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1FU9 _pdbx_database_status.recvd_initial_deposition_date 2000-09-14 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1FV5 _pdbx_database_related.details '1FV5 contains the first zinc finger of U-shaped' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liew, C.K.' 1 'Kowalski, K.' 2 'Fox, A.H.' 3 'Newton, A.' 4 'Sharpe, B.K.' 5 'Crossley, M.' 6 'Mackay, J.P.' 7 # _citation.id primary _citation.title 'Solution structures of two CCHC zinc fingers from the FOG family protein U-shaped that mediate protein-protein interactions.' _citation.journal_abbrev 'Structure Fold.Des.' _citation.journal_volume 8 _citation.page_first 1157 _citation.page_last 1166 _citation.year 2000 _citation.journal_id_ASTM FODEFH _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 1263 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11080638 _citation.pdbx_database_id_DOI '10.1016/S0969-2126(00)00527-X' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liew, C.K.' 1 ? primary 'Kowalski, K.' 2 ? primary 'Fox, A.H.' 3 ? primary 'Newton, A.' 4 ? primary 'Sharpe, B.K.' 5 ? primary 'Crossley, M.' 6 ? primary 'Mackay, J.P.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'U-SHAPED TRANSCRIPTIONAL COFACTOR' 4174.862 1 ? ? 'NINTH ZINC-FINGER DOMAIN' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSAAEVMKKYCSTCDISFNYVKTYLAHKQFYCKNKP _entity_poly.pdbx_seq_one_letter_code_can GSAAEVMKKYCSTCDISFNYVKTYLAHKQFYCKNKP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 ALA n 1 5 GLU n 1 6 VAL n 1 7 MET n 1 8 LYS n 1 9 LYS n 1 10 TYR n 1 11 CYS n 1 12 SER n 1 13 THR n 1 14 CYS n 1 15 ASP n 1 16 ILE n 1 17 SER n 1 18 PHE n 1 19 ASN n 1 20 TYR n 1 21 VAL n 1 22 LYS n 1 23 THR n 1 24 TYR n 1 25 LEU n 1 26 ALA n 1 27 HIS n 1 28 LYS n 1 29 GLN n 1 30 PHE n 1 31 TYR n 1 32 CYS n 1 33 LYS n 1 34 ASN n 1 35 LYS n 1 36 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'fruit fly' _entity_src_gen.gene_src_genus Drosophila _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Drosophila melanogaster' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7227 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PGEX-2T _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 PRO 36 36 36 PRO PRO A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 37 _pdbx_nonpoly_scheme.auth_seq_num 37 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 1FU9 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1FU9 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1FU9 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1FU9 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1FU9 _struct.title 'SOLUTION STRUCTURE OF THE NINTH ZINC-FINGER DOMAIN OF THE U-SHAPED TRANSCRIPTION FACTOR' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1FU9 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'zinc-finger, beta-hairpin + alpha-helix, TRANSCRIPTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code USH_DROME _struct_ref.pdbx_db_accession Q9VPQ6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AAAEVMKKYCSTCDISFNYVKTYLAHKQFYCKNKP _struct_ref.pdbx_align_begin 587 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1FU9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 36 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9VPQ6 _struct_ref_seq.db_align_beg 587 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 620 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 36 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1FU9 GLY A 1 ? UNP Q9VPQ6 ? ? 'cloning artifact' 1 1 1 1FU9 SER A 2 ? UNP Q9VPQ6 ? ? 'cloning artifact' 2 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id TYR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 20 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TYR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 31 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id TYR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 20 _struct_conf.end_auth_comp_id TYR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 31 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 11 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 11 A ZN 37 1_555 ? ? ? ? ? ? ? 2.303 ? ? metalc2 metalc ? ? A CYS 14 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 14 A ZN 37 1_555 ? ? ? ? ? ? ? 2.301 ? ? metalc3 metalc ? ? A HIS 27 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 27 A ZN 37 1_555 ? ? ? ? ? ? ? 2.001 ? ? metalc4 metalc ? ? A CYS 32 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 32 A ZN 37 1_555 ? ? ? ? ? ? ? 2.300 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 37 ? 1_555 SG ? A CYS 14 ? A CYS 14 ? 1_555 109.9 ? 2 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 37 ? 1_555 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 110.9 ? 3 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 37 ? 1_555 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 108.3 ? 4 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 37 ? 1_555 SG ? A CYS 32 ? A CYS 32 ? 1_555 109.2 ? 5 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 37 ? 1_555 SG ? A CYS 32 ? A CYS 32 ? 1_555 109.7 ? 6 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 ZN ? B ZN . ? A ZN 37 ? 1_555 SG ? A CYS 32 ? A CYS 32 ? 1_555 108.7 ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 37 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 37' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 11 ? CYS A 11 . ? 1_555 ? 2 AC1 4 CYS A 14 ? CYS A 14 . ? 1_555 ? 3 AC1 4 HIS A 27 ? HIS A 27 . ? 1_555 ? 4 AC1 4 CYS A 32 ? CYS A 32 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 4 ? ? -73.65 -76.75 2 1 GLU A 5 ? ? 59.57 85.29 3 1 MET A 7 ? ? -174.98 69.60 4 1 LYS A 8 ? ? -94.93 47.51 5 1 LYS A 9 ? ? -158.02 43.93 6 1 TYR A 10 ? ? -165.11 109.34 7 1 ASP A 15 ? ? 72.42 50.53 8 1 PHE A 30 ? ? -150.10 19.35 9 1 LYS A 33 ? ? -98.32 30.49 10 2 ALA A 3 ? ? 61.08 93.69 11 2 ALA A 4 ? ? -59.56 -75.59 12 2 GLU A 5 ? ? -43.79 104.44 13 2 MET A 7 ? ? 62.07 70.29 14 2 TYR A 10 ? ? -165.13 102.33 15 2 ASP A 15 ? ? 74.15 42.51 16 2 PHE A 30 ? ? -149.37 18.15 17 2 LYS A 33 ? ? -98.53 35.44 18 3 MET A 7 ? ? -151.87 65.42 19 3 LYS A 8 ? ? -95.02 48.71 20 3 LYS A 9 ? ? -150.63 65.57 21 3 TYR A 10 ? ? -165.12 115.80 22 3 ASP A 15 ? ? 73.73 53.60 23 3 PHE A 30 ? ? -148.44 16.74 24 3 LYS A 35 ? ? 43.44 72.05 25 4 ALA A 3 ? ? -175.13 95.43 26 4 GLU A 5 ? ? 59.75 165.61 27 4 LYS A 8 ? ? -94.40 48.13 28 4 TYR A 10 ? ? -165.00 109.49 29 4 ASP A 15 ? ? 73.96 45.66 30 4 PHE A 30 ? ? -151.34 19.15 31 5 ALA A 4 ? ? -175.32 -76.15 32 5 GLU A 5 ? ? 59.94 97.21 33 5 MET A 7 ? ? -105.18 61.79 34 5 LYS A 9 ? ? -154.02 53.73 35 5 TYR A 10 ? ? -165.23 108.92 36 5 ASP A 15 ? ? 74.56 39.49 37 5 PHE A 30 ? ? -151.21 19.52 38 6 ALA A 3 ? ? -175.03 36.84 39 6 ALA A 4 ? ? -60.04 -75.55 40 6 GLU A 5 ? ? -43.54 103.70 41 6 LYS A 8 ? ? -95.07 48.79 42 6 LYS A 9 ? ? -151.65 67.32 43 6 TYR A 10 ? ? -165.06 115.76 44 6 ASP A 15 ? ? 74.48 46.57 45 6 PHE A 30 ? ? -150.65 19.72 46 6 ASN A 34 ? ? -102.86 59.23 47 6 LYS A 35 ? ? 60.20 159.17 48 7 SER A 2 ? ? -66.45 -170.08 49 7 ALA A 3 ? ? 60.71 93.38 50 7 GLU A 5 ? ? -43.84 164.26 51 7 MET A 7 ? ? 60.33 72.52 52 7 LYS A 8 ? ? -95.25 44.21 53 7 LYS A 9 ? ? -144.83 43.72 54 7 TYR A 10 ? ? -165.21 106.55 55 7 ASP A 15 ? ? 74.67 41.77 56 7 PHE A 30 ? ? -149.36 18.43 57 7 LYS A 33 ? ? -98.31 35.14 58 8 SER A 2 ? ? -62.25 -173.10 59 8 ALA A 3 ? ? -175.51 95.93 60 8 GLU A 5 ? ? -45.61 94.77 61 8 MET A 7 ? ? 60.29 87.58 62 8 LYS A 9 ? ? -153.52 41.04 63 8 TYR A 10 ? ? -165.28 107.01 64 8 ASP A 15 ? ? 75.18 48.33 65 8 PHE A 30 ? ? -147.78 17.34 66 9 SER A 2 ? ? -62.03 -169.49 67 9 ALA A 3 ? ? -154.98 86.20 68 9 ALA A 4 ? ? -65.55 78.47 69 9 GLU A 5 ? ? 60.37 163.36 70 9 MET A 7 ? ? 65.88 79.18 71 9 LYS A 8 ? ? -94.98 46.22 72 9 LYS A 9 ? ? 62.22 70.42 73 9 TYR A 10 ? ? -165.11 107.27 74 9 ASP A 15 ? ? 70.83 50.57 75 9 PHE A 30 ? ? -151.50 20.91 76 10 SER A 2 ? ? 60.49 160.35 77 10 ALA A 3 ? ? -155.04 30.17 78 10 GLU A 5 ? ? 56.66 84.51 79 10 MET A 7 ? ? -105.17 61.65 80 10 LYS A 8 ? ? -93.53 49.29 81 10 TYR A 10 ? ? -165.23 112.37 82 10 PHE A 30 ? ? -147.55 17.02 83 11 ALA A 3 ? ? 60.59 93.42 84 11 ALA A 4 ? ? -61.66 -71.22 85 11 GLU A 5 ? ? 60.59 162.75 86 11 MET A 7 ? ? -105.15 61.67 87 11 LYS A 8 ? ? -95.02 49.35 88 11 LYS A 9 ? ? -163.57 54.42 89 11 TYR A 10 ? ? -165.08 108.35 90 11 ASP A 15 ? ? 83.04 43.73 91 11 PHE A 30 ? ? -144.59 14.61 92 11 LYS A 35 ? ? 60.58 85.39 93 12 GLU A 5 ? ? 62.92 145.96 94 12 LYS A 8 ? ? -95.11 48.22 95 12 LYS A 9 ? ? -147.24 52.97 96 12 TYR A 10 ? ? -165.09 109.57 97 12 ASP A 15 ? ? 73.21 42.56 98 12 PHE A 30 ? ? -154.30 21.76 99 12 ASN A 34 ? ? -112.73 75.98 100 12 LYS A 35 ? ? 61.50 154.24 101 13 SER A 2 ? ? -174.11 -170.14 102 13 ALA A 4 ? ? -173.68 106.92 103 13 GLU A 5 ? ? -43.71 96.16 104 13 MET A 7 ? ? 62.49 71.04 105 13 LYS A 8 ? ? -94.58 47.63 106 13 TYR A 10 ? ? -165.12 108.49 107 13 ASP A 15 ? ? 74.22 41.40 108 13 PHE A 30 ? ? -147.55 17.11 109 13 LYS A 35 ? ? -161.61 55.32 110 14 ALA A 4 ? ? -151.61 84.42 111 14 GLU A 5 ? ? 63.49 127.26 112 14 MET A 7 ? ? -105.12 61.50 113 14 LYS A 8 ? ? -140.43 46.59 114 14 LYS A 9 ? ? -176.93 74.48 115 14 ASP A 15 ? ? 73.90 52.54 116 14 PHE A 30 ? ? -147.28 16.52 117 14 LYS A 33 ? ? -97.23 34.39 118 14 ASN A 34 ? ? -152.72 78.97 119 15 ALA A 4 ? ? 59.66 91.96 120 15 GLU A 5 ? ? 49.54 96.16 121 15 MET A 7 ? ? -170.88 68.87 122 15 LYS A 8 ? ? -94.76 48.09 123 15 LYS A 9 ? ? -175.13 65.26 124 15 TYR A 10 ? ? -165.14 109.16 125 15 ASP A 15 ? ? 75.37 40.00 126 15 PHE A 30 ? ? -145.57 15.76 127 16 GLU A 5 ? ? 63.27 123.49 128 16 MET A 7 ? ? -172.28 66.16 129 16 LYS A 8 ? ? -95.04 48.64 130 16 TYR A 10 ? ? -165.06 119.49 131 16 ASP A 15 ? ? 73.67 51.67 132 16 PHE A 30 ? ? -150.73 19.32 133 16 ASN A 34 ? ? -90.63 51.46 134 16 LYS A 35 ? ? 60.13 85.68 135 17 SER A 2 ? ? 58.60 -172.01 136 17 ALA A 3 ? ? 61.13 93.88 137 17 LYS A 8 ? ? -94.97 49.39 138 17 LYS A 9 ? ? -96.96 41.06 139 17 ASP A 15 ? ? 76.25 53.38 140 17 PHE A 30 ? ? -148.74 17.33 141 17 ASN A 34 ? ? -117.62 69.79 142 17 LYS A 35 ? ? 43.40 70.07 143 18 SER A 2 ? ? 60.66 -176.46 144 18 ALA A 3 ? ? -155.03 80.90 145 18 ALA A 4 ? ? -108.21 -61.78 146 18 GLU A 5 ? ? 60.09 101.60 147 18 LYS A 8 ? ? -140.18 45.18 148 18 TYR A 10 ? ? -165.26 113.49 149 18 ASP A 15 ? ? 74.46 53.70 150 18 PHE A 30 ? ? -152.71 21.32 151 18 LYS A 33 ? ? -98.32 35.21 152 18 ASN A 34 ? ? -157.97 86.74 153 18 LYS A 35 ? ? -175.85 81.81 154 19 ALA A 3 ? ? -171.67 36.76 155 19 ALA A 4 ? ? 66.29 -74.86 156 19 GLU A 5 ? ? 61.29 114.07 157 19 MET A 7 ? ? -151.05 68.86 158 19 LYS A 8 ? ? -95.09 48.02 159 19 ASP A 15 ? ? 74.25 51.39 160 19 PHE A 30 ? ? -149.02 18.13 161 19 ASN A 34 ? ? -107.15 73.56 162 20 ALA A 3 ? ? -155.29 52.05 163 20 ALA A 4 ? ? 64.07 -79.63 164 20 GLU A 5 ? ? 48.28 91.41 165 20 MET A 7 ? ? 60.08 68.05 166 20 LYS A 8 ? ? -95.13 48.22 167 20 ASP A 15 ? ? 74.19 50.61 168 20 PHE A 30 ? ? -147.67 17.50 169 20 ASN A 34 ? ? 52.22 77.93 # _pdbx_nmr_ensemble.entry_id 1FU9 _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1FU9 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.4mM U-shaped Finger 9; 0.6mM ZnSO4; 0.6mM TCEP; 95% H2O, 5% D2O' '95% H2O/5% D2O' 2 '0.2mM U-shaped Finger 9 U-15N; 0.3mM ZnSO4; 0.3mM TCEP; 95% D2O, 5% H2O' '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 293 ambient 5.0 '0.6mM ZnSO4' ? K 2 293 ambient 5.0 '0.3mM ZnSO4' ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 2 2 HNHA 3 2 2 HNHB # _pdbx_nmr_details.entry_id 1FU9 _pdbx_nmr_details.text 'This structure was determined using a combination of 2D homonuclear and 3D 15N-heteronuclear techniques' # _pdbx_nmr_refine.entry_id 1FU9 _pdbx_nmr_refine.method 'molecular dynamics simulated annealing torsion angle dynamics' _pdbx_nmr_refine.details 'The structures are based on a total of 535 restraints, 506 are NOE-derived distance constraints, 29 are dihedral angle restraints' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.1 processing Bruker 1 XEASY 1.3.13 'data analysis' 'Bartels et al' 2 DYANA 1.5 'structure solution' 'Guntert et al' 3 CNS 0.5 refinement 'Brunger et al' 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 LYS N N N N 175 LYS CA C N S 176 LYS C C N N 177 LYS O O N N 178 LYS CB C N N 179 LYS CG C N N 180 LYS CD C N N 181 LYS CE C N N 182 LYS NZ N N N 183 LYS OXT O N N 184 LYS H H N N 185 LYS H2 H N N 186 LYS HA H N N 187 LYS HB2 H N N 188 LYS HB3 H N N 189 LYS HG2 H N N 190 LYS HG3 H N N 191 LYS HD2 H N N 192 LYS HD3 H N N 193 LYS HE2 H N N 194 LYS HE3 H N N 195 LYS HZ1 H N N 196 LYS HZ2 H N N 197 LYS HZ3 H N N 198 LYS HXT H N N 199 MET N N N N 200 MET CA C N S 201 MET C C N N 202 MET O O N N 203 MET CB C N N 204 MET CG C N N 205 MET SD S N N 206 MET CE C N N 207 MET OXT O N N 208 MET H H N N 209 MET H2 H N N 210 MET HA H N N 211 MET HB2 H N N 212 MET HB3 H N N 213 MET HG2 H N N 214 MET HG3 H N N 215 MET HE1 H N N 216 MET HE2 H N N 217 MET HE3 H N N 218 MET HXT H N N 219 PHE N N N N 220 PHE CA C N S 221 PHE C C N N 222 PHE O O N N 223 PHE CB C N N 224 PHE CG C Y N 225 PHE CD1 C Y N 226 PHE CD2 C Y N 227 PHE CE1 C Y N 228 PHE CE2 C Y N 229 PHE CZ C Y N 230 PHE OXT O N N 231 PHE H H N N 232 PHE H2 H N N 233 PHE HA H N N 234 PHE HB2 H N N 235 PHE HB3 H N N 236 PHE HD1 H N N 237 PHE HD2 H N N 238 PHE HE1 H N N 239 PHE HE2 H N N 240 PHE HZ H N N 241 PHE HXT H N N 242 PRO N N N N 243 PRO CA C N S 244 PRO C C N N 245 PRO O O N N 246 PRO CB C N N 247 PRO CG C N N 248 PRO CD C N N 249 PRO OXT O N N 250 PRO H H N N 251 PRO HA H N N 252 PRO HB2 H N N 253 PRO HB3 H N N 254 PRO HG2 H N N 255 PRO HG3 H N N 256 PRO HD2 H N N 257 PRO HD3 H N N 258 PRO HXT H N N 259 SER N N N N 260 SER CA C N S 261 SER C C N N 262 SER O O N N 263 SER CB C N N 264 SER OG O N N 265 SER OXT O N N 266 SER H H N N 267 SER H2 H N N 268 SER HA H N N 269 SER HB2 H N N 270 SER HB3 H N N 271 SER HG H N N 272 SER HXT H N N 273 THR N N N N 274 THR CA C N S 275 THR C C N N 276 THR O O N N 277 THR CB C N R 278 THR OG1 O N N 279 THR CG2 C N N 280 THR OXT O N N 281 THR H H N N 282 THR H2 H N N 283 THR HA H N N 284 THR HB H N N 285 THR HG1 H N N 286 THR HG21 H N N 287 THR HG22 H N N 288 THR HG23 H N N 289 THR HXT H N N 290 TYR N N N N 291 TYR CA C N S 292 TYR C C N N 293 TYR O O N N 294 TYR CB C N N 295 TYR CG C Y N 296 TYR CD1 C Y N 297 TYR CD2 C Y N 298 TYR CE1 C Y N 299 TYR CE2 C Y N 300 TYR CZ C Y N 301 TYR OH O N N 302 TYR OXT O N N 303 TYR H H N N 304 TYR H2 H N N 305 TYR HA H N N 306 TYR HB2 H N N 307 TYR HB3 H N N 308 TYR HD1 H N N 309 TYR HD2 H N N 310 TYR HE1 H N N 311 TYR HE2 H N N 312 TYR HH H N N 313 TYR HXT H N N 314 VAL N N N N 315 VAL CA C N S 316 VAL C C N N 317 VAL O O N N 318 VAL CB C N N 319 VAL CG1 C N N 320 VAL CG2 C N N 321 VAL OXT O N N 322 VAL H H N N 323 VAL H2 H N N 324 VAL HA H N N 325 VAL HB H N N 326 VAL HG11 H N N 327 VAL HG12 H N N 328 VAL HG13 H N N 329 VAL HG21 H N N 330 VAL HG22 H N N 331 VAL HG23 H N N 332 VAL HXT H N N 333 ZN ZN ZN N N 334 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 ILE N CA sing N N 124 ILE N H sing N N 125 ILE N H2 sing N N 126 ILE CA C sing N N 127 ILE CA CB sing N N 128 ILE CA HA sing N N 129 ILE C O doub N N 130 ILE C OXT sing N N 131 ILE CB CG1 sing N N 132 ILE CB CG2 sing N N 133 ILE CB HB sing N N 134 ILE CG1 CD1 sing N N 135 ILE CG1 HG12 sing N N 136 ILE CG1 HG13 sing N N 137 ILE CG2 HG21 sing N N 138 ILE CG2 HG22 sing N N 139 ILE CG2 HG23 sing N N 140 ILE CD1 HD11 sing N N 141 ILE CD1 HD12 sing N N 142 ILE CD1 HD13 sing N N 143 ILE OXT HXT sing N N 144 LEU N CA sing N N 145 LEU N H sing N N 146 LEU N H2 sing N N 147 LEU CA C sing N N 148 LEU CA CB sing N N 149 LEU CA HA sing N N 150 LEU C O doub N N 151 LEU C OXT sing N N 152 LEU CB CG sing N N 153 LEU CB HB2 sing N N 154 LEU CB HB3 sing N N 155 LEU CG CD1 sing N N 156 LEU CG CD2 sing N N 157 LEU CG HG sing N N 158 LEU CD1 HD11 sing N N 159 LEU CD1 HD12 sing N N 160 LEU CD1 HD13 sing N N 161 LEU CD2 HD21 sing N N 162 LEU CD2 HD22 sing N N 163 LEU CD2 HD23 sing N N 164 LEU OXT HXT sing N N 165 LYS N CA sing N N 166 LYS N H sing N N 167 LYS N H2 sing N N 168 LYS CA C sing N N 169 LYS CA CB sing N N 170 LYS CA HA sing N N 171 LYS C O doub N N 172 LYS C OXT sing N N 173 LYS CB CG sing N N 174 LYS CB HB2 sing N N 175 LYS CB HB3 sing N N 176 LYS CG CD sing N N 177 LYS CG HG2 sing N N 178 LYS CG HG3 sing N N 179 LYS CD CE sing N N 180 LYS CD HD2 sing N N 181 LYS CD HD3 sing N N 182 LYS CE NZ sing N N 183 LYS CE HE2 sing N N 184 LYS CE HE3 sing N N 185 LYS NZ HZ1 sing N N 186 LYS NZ HZ2 sing N N 187 LYS NZ HZ3 sing N N 188 LYS OXT HXT sing N N 189 MET N CA sing N N 190 MET N H sing N N 191 MET N H2 sing N N 192 MET CA C sing N N 193 MET CA CB sing N N 194 MET CA HA sing N N 195 MET C O doub N N 196 MET C OXT sing N N 197 MET CB CG sing N N 198 MET CB HB2 sing N N 199 MET CB HB3 sing N N 200 MET CG SD sing N N 201 MET CG HG2 sing N N 202 MET CG HG3 sing N N 203 MET SD CE sing N N 204 MET CE HE1 sing N N 205 MET CE HE2 sing N N 206 MET CE HE3 sing N N 207 MET OXT HXT sing N N 208 PHE N CA sing N N 209 PHE N H sing N N 210 PHE N H2 sing N N 211 PHE CA C sing N N 212 PHE CA CB sing N N 213 PHE CA HA sing N N 214 PHE C O doub N N 215 PHE C OXT sing N N 216 PHE CB CG sing N N 217 PHE CB HB2 sing N N 218 PHE CB HB3 sing N N 219 PHE CG CD1 doub Y N 220 PHE CG CD2 sing Y N 221 PHE CD1 CE1 sing Y N 222 PHE CD1 HD1 sing N N 223 PHE CD2 CE2 doub Y N 224 PHE CD2 HD2 sing N N 225 PHE CE1 CZ doub Y N 226 PHE CE1 HE1 sing N N 227 PHE CE2 CZ sing Y N 228 PHE CE2 HE2 sing N N 229 PHE CZ HZ sing N N 230 PHE OXT HXT sing N N 231 PRO N CA sing N N 232 PRO N CD sing N N 233 PRO N H sing N N 234 PRO CA C sing N N 235 PRO CA CB sing N N 236 PRO CA HA sing N N 237 PRO C O doub N N 238 PRO C OXT sing N N 239 PRO CB CG sing N N 240 PRO CB HB2 sing N N 241 PRO CB HB3 sing N N 242 PRO CG CD sing N N 243 PRO CG HG2 sing N N 244 PRO CG HG3 sing N N 245 PRO CD HD2 sing N N 246 PRO CD HD3 sing N N 247 PRO OXT HXT sing N N 248 SER N CA sing N N 249 SER N H sing N N 250 SER N H2 sing N N 251 SER CA C sing N N 252 SER CA CB sing N N 253 SER CA HA sing N N 254 SER C O doub N N 255 SER C OXT sing N N 256 SER CB OG sing N N 257 SER CB HB2 sing N N 258 SER CB HB3 sing N N 259 SER OG HG sing N N 260 SER OXT HXT sing N N 261 THR N CA sing N N 262 THR N H sing N N 263 THR N H2 sing N N 264 THR CA C sing N N 265 THR CA CB sing N N 266 THR CA HA sing N N 267 THR C O doub N N 268 THR C OXT sing N N 269 THR CB OG1 sing N N 270 THR CB CG2 sing N N 271 THR CB HB sing N N 272 THR OG1 HG1 sing N N 273 THR CG2 HG21 sing N N 274 THR CG2 HG22 sing N N 275 THR CG2 HG23 sing N N 276 THR OXT HXT sing N N 277 TYR N CA sing N N 278 TYR N H sing N N 279 TYR N H2 sing N N 280 TYR CA C sing N N 281 TYR CA CB sing N N 282 TYR CA HA sing N N 283 TYR C O doub N N 284 TYR C OXT sing N N 285 TYR CB CG sing N N 286 TYR CB HB2 sing N N 287 TYR CB HB3 sing N N 288 TYR CG CD1 doub Y N 289 TYR CG CD2 sing Y N 290 TYR CD1 CE1 sing Y N 291 TYR CD1 HD1 sing N N 292 TYR CD2 CE2 doub Y N 293 TYR CD2 HD2 sing N N 294 TYR CE1 CZ doub Y N 295 TYR CE1 HE1 sing N N 296 TYR CE2 CZ sing Y N 297 TYR CE2 HE2 sing N N 298 TYR CZ OH sing N N 299 TYR OH HH sing N N 300 TYR OXT HXT sing N N 301 VAL N CA sing N N 302 VAL N H sing N N 303 VAL N H2 sing N N 304 VAL CA C sing N N 305 VAL CA CB sing N N 306 VAL CA HA sing N N 307 VAL C O doub N N 308 VAL C OXT sing N N 309 VAL CB CG1 sing N N 310 VAL CB CG2 sing N N 311 VAL CB HB sing N N 312 VAL CG1 HG11 sing N N 313 VAL CG1 HG12 sing N N 314 VAL CG1 HG13 sing N N 315 VAL CG2 HG21 sing N N 316 VAL CG2 HG22 sing N N 317 VAL CG2 HG23 sing N N 318 VAL OXT HXT sing N N 319 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1FU9 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_