data_1G10 # _entry.id 1G10 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1G10 pdb_00001g10 10.2210/pdb1g10/pdb RCSB RCSB012098 ? ? WWPDB D_1000012098 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1g11 'ensemble of 20 structures' unspecified BMRB 4560 'chemical shifts assignments' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1G10 _pdbx_database_status.recvd_initial_deposition_date 2000-10-10 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hemmi, H.' 1 'Studts, J.M.' 2 'Chae, Y.K.' 3 'Song, J.' 4 'Markley, J.L.' 5 'Fox, B.G.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of the toluene 4-monooxygenase effector protein (T4moD).' Biochemistry 40 3512 3524 2001 BICHAW US 0006-2960 0033 ? 11297417 10.1021/bi0013703 1 'Assignment of 1H, 13C and 15N NMR Signals in the Toluene 4-monooxygenase Effector Protein' J.BIOMOL.NMR 16 359 360 2000 JBNME9 NE 0925-2738 0800 ? ? 10.1023/A:1008333115661 2 'Application of Fed-batch Fermentation to the Preparation of Isotopicaly Labeled or Selenomethionyl-labeled Proteins' 'PROTEIN EXPR.PURIF.' 16 109 119 1999 PEXPEJ US 1046-5928 0757 ? ? 10.1006/prep.1999.1067 3 ;Detection and Classification of Hyperfine-shifted 1H, 2H, and 15N Resonances of the Rieske Ferredoxin Component from Toluene 4-monooxygenase ; Biochemistry 38 727 739 1999 BICHAW US 0006-2960 0033 ? ? 10.1021/bi981851a 4 ;Recombinant Toluene-4-monooxygenase: Catalytic and Mossbauer Studies of the Purified Diiron and Rieske Components of a Four-Protein Complex ; Biochemistry 35 9106 9119 1996 BICHAW US 0006-2960 0033 ? ? 10.1021/bi960456m 5 ;Toluene-4-monooxygenase, a Three Component Enzyme System that Catalyzes the Oxidation of Toluene to p-Cresol in Pseudomonas mendocina KR1 ; J.BACTERIOL. 173 3010 3016 1991 JOBAAY US 0021-9193 0767 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hemmi, H.' 1 ? primary 'Studts, J.M.' 2 ? primary 'Chae, Y.K.' 3 ? primary 'Song, J.' 4 ? primary 'Markley, J.L.' 5 ? primary 'Fox, B.G.' 6 ? 1 'Hemmi, H.' 7 ? 1 'Studts, J.M.' 8 ? 1 'Chae, Y.K.' 9 ? 1 'Fox, B.G.' 10 ? 1 'Markley, J.L.' 11 ? 2 'Studts, J.M.' 12 ? 2 'Fox, B.G.' 13 ? 3 'Xia, B.' 14 ? 3 'Pikus, J.D.' 15 ? 3 'Xia, W.' 16 ? 3 'McClay, K.' 17 ? 3 'Steffan, R.J.' 18 ? 3 'Chae, Y.K.' 19 ? 3 'Westler, M.M.' 20 ? 3 'Markley, J.L.' 21 ? 3 'Fox, B.G.' 22 ? 4 'Pikus, J.D.' 23 ? 4 'M Studts, J.' 24 ? 4 'Achim, C.' 25 ? 4 'Kauffmann, K.E.' 26 ? 4 'Munck, E.' 27 ? 4 'Steffan, R.J.' 28 ? 4 'Mcclay, K.' 29 ? 4 'Fox, B.G.' 30 ? 5 'Whited, G.M.' 31 ? 5 'Gibson, D.T.' 32 ? # _cell.entry_id 1G10 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1G10 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TOLUENE-4-MONOOXYGENASE CATALYTIC EFFECTOR' _entity.formula_weight 11497.836 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 1.14.13.- _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TOLUENE-4-MONOOXYGENASE SYSTEM PROTEIN D, T4MOD' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;STLADQALHNNNVGPIIRAGDLVEPVIETAEIDNPGKEITVEDRRAYVRIAAEGELILTRKTLEEQLGRPFNMQELEINL ASFAGQIQADEDQIRFYFDKTM ; _entity_poly.pdbx_seq_one_letter_code_can ;STLADQALHNNNVGPIIRAGDLVEPVIETAEIDNPGKEITVEDRRAYVRIAAEGELILTRKTLEEQLGRPFNMQELEINL ASFAGQIQADEDQIRFYFDKTM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 THR n 1 3 LEU n 1 4 ALA n 1 5 ASP n 1 6 GLN n 1 7 ALA n 1 8 LEU n 1 9 HIS n 1 10 ASN n 1 11 ASN n 1 12 ASN n 1 13 VAL n 1 14 GLY n 1 15 PRO n 1 16 ILE n 1 17 ILE n 1 18 ARG n 1 19 ALA n 1 20 GLY n 1 21 ASP n 1 22 LEU n 1 23 VAL n 1 24 GLU n 1 25 PRO n 1 26 VAL n 1 27 ILE n 1 28 GLU n 1 29 THR n 1 30 ALA n 1 31 GLU n 1 32 ILE n 1 33 ASP n 1 34 ASN n 1 35 PRO n 1 36 GLY n 1 37 LYS n 1 38 GLU n 1 39 ILE n 1 40 THR n 1 41 VAL n 1 42 GLU n 1 43 ASP n 1 44 ARG n 1 45 ARG n 1 46 ALA n 1 47 TYR n 1 48 VAL n 1 49 ARG n 1 50 ILE n 1 51 ALA n 1 52 ALA n 1 53 GLU n 1 54 GLY n 1 55 GLU n 1 56 LEU n 1 57 ILE n 1 58 LEU n 1 59 THR n 1 60 ARG n 1 61 LYS n 1 62 THR n 1 63 LEU n 1 64 GLU n 1 65 GLU n 1 66 GLN n 1 67 LEU n 1 68 GLY n 1 69 ARG n 1 70 PRO n 1 71 PHE n 1 72 ASN n 1 73 MET n 1 74 GLN n 1 75 GLU n 1 76 LEU n 1 77 GLU n 1 78 ILE n 1 79 ASN n 1 80 LEU n 1 81 ALA n 1 82 SER n 1 83 PHE n 1 84 ALA n 1 85 GLY n 1 86 GLN n 1 87 ILE n 1 88 GLN n 1 89 ALA n 1 90 ASP n 1 91 GLU n 1 92 ASP n 1 93 GLN n 1 94 ILE n 1 95 ARG n 1 96 PHE n 1 97 TYR n 1 98 PHE n 1 99 ASP n 1 100 LYS n 1 101 THR n 1 102 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pseudomonas _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain KR1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas mendocina' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 300 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET15B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_code TMOD_PSEME _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q00459 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;STLADQALHNNNVGPIIRAGDLVEPVIETAEIDNPGKEITVEDRRAYVRIAAEGELILTRKTLEEQLGRPFNMQELEINL ASFAGQIQADEDQIRFYFDKTM ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1G10 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 102 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q00459 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 102 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 102 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type 'H-15N HSQC,HNCA,HN(CO)CA,C(CO)NH,HNCACB,HCCH-COSY,HCCH-TOCSY,2D_1H-NOESY,2D_1H-TOCSY,CT-13C-HSQC,3D_NOESY-CT-HSCQ,3D_TOCSY-CT-HSQC' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 ambient 7.0 67 ? K 2 298 ambient 7.0 67 ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1.1 MM [U-13C,U-15N] T4MOD' ;50 MM PHOSPHATE PH 7.0, 90% H20/10% D20 OR 99.9% D20, 0.5 UM AZIDE, PROTEASE INHIBITOR COCKTAIL PRODUCT NO. P 27124, SIGMA CHEMICAL CO, ST. LOUIS, MO ; 2 '3.0 MM [NA] T4MOD' ;50 MM PHOSPHATE PH 7.0, 90% H20/10% D20 OR 99.9% D20, 0.5 UM AZIDE, PROTEASE INHIBITOR COCKTAIL PRODUCT NO. P 27124, SIGMA CHEMICAL CO, ST. LOUIS, MO ; # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 500 2 ? Bruker DMX 600 # _pdbx_nmr_refine.entry_id 1G10 _pdbx_nmr_refine.method 'DISTANCE GEOMETRY SIMULATED ANNEALING, TORSION ANGLE MOLECULAR DYNAMICS' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1G10 _pdbx_nmr_details.text ;123 1H-15N CROSS PEAKS WERE ASSIGNED OUT OF THE EXPECTED 129 CROSS PEAKS (95% COMPLETE). 386 BACKBONE RESONANCES WERE ASSIGNED OUT OF THE EXPECTED 400 RESONANCES (97% COMPLETE). 789 SIDECHAIN RESONANCES WERE ASSIGNED OUT OF THE EXPECTED 901 RESONANCES (88% COMPLETE). ARG SIDECHAIN ATOMS ACCOUNT FOR 51 OF 112 UNASSIGNED SIDECHAIN ATOMS (51%). ; # _pdbx_nmr_ensemble.entry_id 1G10 _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1G10 _pdbx_nmr_representative.conformer_id ? _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 3.843 'structure solution' Brunger 1 DYANA 1.5 refinement 'Gunter, Mumenthaler, Wutrich' 2 # _exptl.entry_id 1G10 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1G10 _struct.title 'TOLUENE-4-MONOOXYGENASE CATALYTIC EFFECTOR PROTEIN NMR STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1G10 _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'aromatic hydrocarbon catabolism, OXIDOREDUCTASE, MONOOXYGENASE, TOLUENE OXIDATION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 22 ? ASP A 33 ? LEU A 22 ASP A 33 1 ? 12 HELX_P HELX_P2 2 ARG A 60 ? LEU A 67 ? ARG A 60 LEU A 67 1 ? 8 HELX_P HELX_P3 3 MET A 73 ? ASN A 79 ? MET A 73 ASN A 79 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 16 ? ARG A 18 ? ILE A 16 ARG A 18 A 2 TYR A 47 ? ALA A 51 ? TYR A 47 ALA A 51 A 3 THR A 40 ? ASP A 43 ? THR A 40 ASP A 43 B 1 GLU A 55 ? LEU A 58 ? GLU A 55 LEU A 58 B 2 GLN A 93 ? TYR A 97 ? GLN A 93 TYR A 97 B 3 GLN A 86 ? ASP A 90 ? GLN A 86 ASP A 90 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 17 ? O ILE A 17 N VAL A 48 ? N VAL A 48 A 2 3 O ALA A 51 ? O ALA A 51 N THR A 40 ? N THR A 40 B 1 2 N LEU A 58 ? N LEU A 58 O ILE A 94 ? O ILE A 94 B 2 3 O TYR A 97 ? O TYR A 97 N GLN A 86 ? N GLN A 86 # _database_PDB_matrix.entry_id 1G10 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1G10 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 MET 102 102 102 MET MET A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-05-09 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PRO 25 ? ? HG1 A THR 29 ? ? 1.58 2 1 O A GLU 75 ? ? H A ASN 79 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 7 ? ? -179.78 63.21 2 1 HIS A 9 ? ? 85.80 164.70 3 1 ASN A 11 ? ? -149.47 -69.69 4 1 ASN A 12 ? ? -177.25 145.38 5 1 ASP A 21 ? ? 179.56 134.36 6 1 LYS A 37 ? ? -83.63 47.34 7 1 GLU A 38 ? ? 178.75 47.97 8 1 ARG A 45 ? ? 161.73 -47.69 9 1 ARG A 60 ? ? -86.41 44.01 10 1 PHE A 71 ? ? -158.13 -157.42 11 1 ALA A 81 ? ? -125.13 -60.26 12 1 LYS A 100 ? ? -81.08 -98.62 #