data_1G1Z # _entry.id 1G1Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1G1Z pdb_00001g1z 10.2210/pdb1g1z/pdb RCSB RCSB012133 ? ? WWPDB D_1000012133 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1G1P _pdbx_database_related.details '1G1P represents the conotoxin EVIA with the Leu12-Pro13 trans peptide bond.' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1G1Z _pdbx_database_status.recvd_initial_deposition_date 2000-10-16 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Volpon, L.' 1 'Lamthanh, H.' 2 'Le Gall, F.' 3 'Menez, A.' 4 'Lancelin, J.M.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'NMR Solution Structures of delta-Conotoxin EVIA from Conus ermineus That Selectively Acts on Vertebrate Neuronal Na+ Channels.' J.Biol.Chem. 279 21356 21366 2004 JBCHA3 US 0021-9258 0071 ? 14976206 10.1074/jbc.M309594200 1 'Conotoxin EVIA, a Novel Peptide from Conus ermineus Venom that Preferentially Acts on Neuronal Voltage-dependent Sodium Channels' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Volpon, L.' 1 ? primary 'Lamthanh, H.' 2 ? primary 'Barbier, J.' 3 ? primary 'Gilles, N.' 4 ? primary 'Lancelin, J.M.' 5 ? 1 'Barbier, J.' 6 ? 1 'Lamthanh, H.' 7 ? 1 'Le Gall, F.' 8 ? 1 'Favreau, P.' 9 ? 1 'Benoit, E.' 10 ? 1 'Chen, H.' 11 ? 1 'Gilles, N.' 12 ? 1 'Ilan, N.' 13 ? 1 'Heinemann, S.F.' 14 ? 1 'Gordon, D.' 15 ? 1 'Menez, A.' 16 ? 1 'Molgo, J.' 17 ? # _cell.entry_id 1G1Z _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1G1Z _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'CONOTOXIN EVIA' _entity.formula_weight 3294.909 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'THIS STRUCTURE IS IN EQUILIBRIUM WITH THE LEU12-PRO13 TRANS ISOMER (1G1P).' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'DDCIK(HYP)YGFCSLPILKNGLCCSGACVGVCADL(NH2)' _entity_poly.pdbx_seq_one_letter_code_can DDCIKPYGFCSLPILKNGLCCSGACVGVCADLX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 ASP n 1 3 CYS n 1 4 ILE n 1 5 LYS n 1 6 HYP n 1 7 TYR n 1 8 GLY n 1 9 PHE n 1 10 CYS n 1 11 SER n 1 12 LEU n 1 13 PRO n 1 14 ILE n 1 15 LEU n 1 16 LYS n 1 17 ASN n 1 18 GLY n 1 19 LEU n 1 20 CYS n 1 21 CYS n 1 22 SER n 1 23 GLY n 1 24 ALA n 1 25 CYS n 1 26 VAL n 1 27 GLY n 1 28 VAL n 1 29 CYS n 1 30 ALA n 1 31 ASP n 1 32 LEU n 1 33 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details ;The solid phase synthesis of conotoxin EVIA was carried out using the F-moc chemistry. The sequence of the peptide is naturally found in Conus ermineus (Atlantic fish-hunting cone). ; # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CXD6A_CONER _struct_ref.pdbx_db_accession P60513 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1G1Z _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 32 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P60513 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 32 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 32 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HYP 'L-peptide linking' n 4-HYDROXYPROLINE HYDROXYPROLINE 'C5 H9 N O3' 131.130 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 NOESY 2 1 1 DQF-COSY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 283 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 3.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.01 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2 mM conotoxin EVIA; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1G1Z _pdbx_nmr_refine.method ;hybrid distance geometry dynamical simulated annealing with the allhdg force field and simulated annealing with the CHARMM22 force field ; _pdbx_nmr_refine.details ;the structures are based on a total of 257 restraints, 211 are NOE-derived distance constraints, 24 dihedral angle restraints, 22 distance restraints from hydrogen bonds. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1G1Z _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques' # _pdbx_nmr_ensemble.entry_id 1G1Z _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 18 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1G1Z _pdbx_nmr_representative.conformer_id 14 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 Gifa 4.22 'data analysis' Delsuc 2 X-PLOR 3.851 refinement Brunger 3 CHARMM 22 refinement Brooks 4 # _exptl.entry_id 1G1Z _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1G1Z _struct.title ;NMR Solution Structures of delta-Conotoxin EVIA from Conus ermineus that Selectively Acts on Vertebrate Neuronal Na+ Channels, LEU12-PRO13 Cis isomer ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1G1Z _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'three disulfide linkages, cis/trans isomerism of Leu12-Pro13 peptide bond, hydroxyproline, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 3 A CYS 21 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 10 A CYS 25 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 20 A CYS 29 1_555 ? ? ? ? ? ? ? 2.014 ? ? covale1 covale both ? A LYS 5 C ? ? ? 1_555 A HYP 6 N ? ? A LYS 5 A HYP 6 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale2 covale both ? A HYP 6 C ? ? ? 1_555 A TYR 7 N ? ? A HYP 6 A TYR 7 1_555 ? ? ? ? ? ? ? 1.357 ? ? covale3 covale both ? A LEU 32 C ? ? ? 1_555 A NH2 33 N ? ? A LEU 32 A NH2 33 1_555 ? ? ? ? ? ? ? 1.358 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 1 -6.31 2 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 2 -1.15 3 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 3 14.56 4 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 4 -23.72 5 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 5 -2.57 6 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 6 -16.82 7 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 7 -9.27 8 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 8 17.58 9 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 9 5.63 10 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 10 -8.57 11 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 11 -1.54 12 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 12 0.99 13 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 13 -23.29 14 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 14 -19.19 15 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 15 -5.08 16 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 16 -1.20 17 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 17 -10.90 18 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 18 -10.48 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 24 ? CYS A 25 ? ALA A 24 CYS A 25 A 2 CYS A 29 ? ALA A 30 ? CYS A 29 ALA A 30 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id ALA _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 24 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id ALA _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 24 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id ALA _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 30 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id ALA _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 30 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NH2 _struct_site.pdbx_auth_seq_id 33 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 1 _struct_site.details 'BINDING SITE FOR RESIDUE NH2 A 33' # _struct_site_gen.id 1 _struct_site_gen.site_id AC1 _struct_site_gen.pdbx_num_res 1 _struct_site_gen.label_comp_id LEU _struct_site_gen.label_asym_id A _struct_site_gen.label_seq_id 32 _struct_site_gen.pdbx_auth_ins_code ? _struct_site_gen.auth_comp_id LEU _struct_site_gen.auth_asym_id A _struct_site_gen.auth_seq_id 32 _struct_site_gen.label_atom_id . _struct_site_gen.label_alt_id ? _struct_site_gen.symmetry 1_555 _struct_site_gen.details ? # _database_PDB_matrix.entry_id 1G1Z _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1G1Z _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 HYP 6 6 6 HYP HYP A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 NH2 33 33 33 NH2 NH2 A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id HYP _pdbx_struct_mod_residue.label_seq_id 6 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id HYP _pdbx_struct_mod_residue.auth_seq_id 6 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id PRO _pdbx_struct_mod_residue.details 4-HYDROXYPROLINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-11-01 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 HG A SER 22 ? ? O A ALA 30 ? ? 1.58 2 3 HG A SER 11 ? ? OD1 A ASN 17 ? ? 1.58 3 7 HG A SER 22 ? ? O A ALA 30 ? ? 1.59 4 8 HG A SER 11 ? ? OD1 A ASN 17 ? ? 1.58 5 9 HG A SER 22 ? ? O A ALA 30 ? ? 1.60 6 14 HG A SER 22 ? ? O A ALA 30 ? ? 1.59 7 15 HG A SER 22 ? ? O A ALA 30 ? ? 1.60 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 N A LEU 32 ? ? CA A LEU 32 ? ? C A LEU 32 ? ? 93.89 111.00 -17.11 2.70 N 2 3 N A LEU 32 ? ? CA A LEU 32 ? ? C A LEU 32 ? ? 94.34 111.00 -16.66 2.70 N 3 4 N A SER 11 ? ? CA A SER 11 ? ? C A SER 11 ? ? 94.65 111.00 -16.35 2.70 N 4 5 N A GLY 18 ? ? CA A GLY 18 ? ? C A GLY 18 ? ? 97.31 113.10 -15.79 2.50 N 5 8 N A LEU 32 ? ? CA A LEU 32 ? ? C A LEU 32 ? ? 94.36 111.00 -16.64 2.70 N 6 9 N A LEU 32 ? ? CA A LEU 32 ? ? C A LEU 32 ? ? 94.55 111.00 -16.45 2.70 N 7 10 N A LEU 12 ? ? CA A LEU 12 ? ? C A LEU 12 ? ? 94.37 111.00 -16.63 2.70 N 8 10 N A GLY 18 ? ? CA A GLY 18 ? ? C A GLY 18 ? ? 97.22 113.10 -15.88 2.50 N 9 13 N A ILE 14 ? ? CA A ILE 14 ? ? C A ILE 14 ? ? 94.71 111.00 -16.29 2.70 N 10 13 N A GLY 18 ? ? CA A GLY 18 ? ? C A GLY 18 ? ? 97.42 113.10 -15.68 2.50 N 11 13 N A LEU 32 ? ? CA A LEU 32 ? ? C A LEU 32 ? ? 94.57 111.00 -16.43 2.70 N 12 14 N A LEU 12 ? ? CA A LEU 12 ? ? C A LEU 12 ? ? 94.50 111.00 -16.50 2.70 N 13 14 N A GLY 18 ? ? CA A GLY 18 ? ? C A GLY 18 ? ? 97.11 113.10 -15.99 2.50 N 14 14 N A LEU 32 ? ? CA A LEU 32 ? ? C A LEU 32 ? ? 94.43 111.00 -16.57 2.70 N 15 15 N A LEU 32 ? ? CA A LEU 32 ? ? C A LEU 32 ? ? 94.68 111.00 -16.32 2.70 N 16 17 N A LYS 16 ? ? CA A LYS 16 ? ? C A LYS 16 ? ? 93.22 111.00 -17.78 2.70 N 17 18 N A VAL 26 ? ? CA A VAL 26 ? ? C A VAL 26 ? ? 92.97 111.00 -18.03 2.70 N 18 18 N A LEU 32 ? ? CA A LEU 32 ? ? C A LEU 32 ? ? 93.19 111.00 -17.81 2.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -172.67 -170.68 2 1 CYS A 10 ? ? -111.21 -123.31 3 1 LEU A 15 ? ? -137.45 -63.13 4 1 ASN A 17 ? ? -162.05 -166.66 5 1 VAL A 26 ? ? -160.32 60.49 6 1 ALA A 30 ? ? -150.37 -153.86 7 2 CYS A 3 ? ? -176.46 -177.88 8 2 VAL A 26 ? ? -145.03 54.79 9 2 ALA A 30 ? ? -129.84 -153.26 10 3 ASP A 2 ? ? -97.29 -71.99 11 3 ASN A 17 ? ? -89.57 -109.63 12 3 VAL A 26 ? ? -144.99 48.10 13 3 ALA A 30 ? ? -143.94 -143.70 14 4 ILE A 14 ? ? -150.03 -46.04 15 4 LEU A 15 ? ? -117.33 -151.73 16 4 LYS A 16 ? ? -91.81 59.96 17 4 ASN A 17 ? ? -83.84 -122.71 18 4 VAL A 26 ? ? -150.59 49.07 19 4 ALA A 30 ? ? -129.32 -162.36 20 5 PRO A 13 ? ? -69.72 -77.24 21 5 LEU A 15 ? ? -140.44 -98.19 22 5 ASN A 17 ? ? 177.19 -173.35 23 5 ALA A 30 ? ? -142.16 -145.25 24 6 SER A 11 ? ? -164.09 -125.24 25 6 LEU A 15 ? ? 79.08 -35.47 26 6 ASN A 17 ? ? -133.85 -129.63 27 6 VAL A 26 ? ? -151.36 56.57 28 6 ALA A 30 ? ? -145.12 -153.37 29 7 CYS A 10 ? ? -109.60 -115.00 30 7 SER A 11 ? ? -167.15 -163.30 31 7 LEU A 15 ? ? -124.72 -79.08 32 7 ASN A 17 ? ? -160.36 -50.06 33 7 VAL A 26 ? ? -160.03 58.65 34 7 ALA A 30 ? ? -140.65 -150.09 35 8 ASP A 2 ? ? -88.79 -77.75 36 8 LEU A 15 ? ? 75.19 -48.58 37 8 ASN A 17 ? ? -80.50 -70.07 38 8 VAL A 26 ? ? -115.71 -130.39 39 8 ALA A 30 ? ? -133.44 -154.75 40 8 ASP A 31 ? ? -124.88 -163.59 41 9 LEU A 15 ? ? -137.00 -77.09 42 9 ASN A 17 ? ? 176.91 175.41 43 9 VAL A 26 ? ? -144.53 44.39 44 9 ALA A 30 ? ? -152.58 -151.87 45 10 ASP A 2 ? ? 69.66 -103.69 46 10 LEU A 15 ? ? -108.92 -64.00 47 10 LYS A 16 ? ? -152.24 42.01 48 10 ASN A 17 ? ? -90.49 -144.37 49 10 VAL A 26 ? ? -130.04 -132.37 50 11 ILE A 14 ? ? 42.08 -112.87 51 11 LEU A 15 ? ? -134.66 -146.71 52 11 VAL A 26 ? ? -115.79 -132.59 53 11 ALA A 30 ? ? -129.68 -149.92 54 12 CYS A 10 ? ? -134.36 -157.81 55 12 SER A 11 ? ? -173.23 -177.13 56 12 LEU A 15 ? ? -167.12 -96.80 57 12 VAL A 26 ? ? -142.41 37.59 58 12 ALA A 30 ? ? -134.62 -159.51 59 13 SER A 11 ? ? -173.68 -169.31 60 13 VAL A 26 ? ? -149.54 46.80 61 13 ALA A 30 ? ? -145.43 -141.97 62 14 ASP A 2 ? ? 75.72 -67.58 63 14 VAL A 26 ? ? -122.62 -137.24 64 14 ALA A 30 ? ? -130.74 -146.09 65 15 ASP A 2 ? ? -93.38 -153.42 66 15 CYS A 10 ? ? -109.09 -90.91 67 15 SER A 11 ? ? -170.56 -176.02 68 15 LEU A 15 ? ? 111.78 -110.85 69 15 ASN A 17 ? ? -174.73 -60.61 70 15 VAL A 26 ? ? -140.73 42.85 71 15 ALA A 30 ? ? -141.81 -146.58 72 16 ASP A 2 ? ? -125.78 -76.55 73 16 ASN A 17 ? ? 178.95 -172.43 74 16 VAL A 26 ? ? -141.99 45.61 75 16 ALA A 30 ? ? -135.68 -158.58 76 17 CYS A 3 ? ? 175.26 -175.01 77 17 LEU A 15 ? ? -171.41 -64.40 78 17 LYS A 16 ? ? -117.46 -101.32 79 17 ALA A 30 ? ? -148.82 -147.40 80 18 ASP A 2 ? ? -166.55 -165.26 81 18 ILE A 14 ? ? 80.63 -91.09 82 18 ASN A 17 ? ? -77.41 -87.61 83 18 LEU A 19 ? ? -91.57 -155.15 84 18 VAL A 26 ? ? -159.30 -142.02 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 15 _pdbx_validate_peptide_omega.auth_comp_id_1 ASP _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 1 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ASP _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 2 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 147.83 #