data_1G47 # _entry.id 1G47 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1G47 pdb_00001g47 10.2210/pdb1g47/pdb RCSB RCSB012211 ? ? WWPDB D_1000012211 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-02-21 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.value' 14 4 'Structure model' '_struct_conn.pdbx_dist_value' 15 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 16 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 17 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 27 4 'Structure model' '_struct_ref_seq_dif.details' 28 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 29 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 30 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1G47 _pdbx_database_status.recvd_initial_deposition_date 2000-10-26 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 4884 _pdbx_database_related.details 'chemical shifts for this protein domain' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Velyvis, A.' 1 'Yang, Y.' 2 'Wu, C.' 3 'Qin, J.' 4 # _citation.id primary _citation.title ;Solution structure of the focal adhesion adaptor PINCH LIM1 domain and characterization of its interaction with the integrin-linked kinase ankyrin repeat domain. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 276 _citation.page_first 4932 _citation.page_last 4939 _citation.year 2001 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11078733 _citation.pdbx_database_id_DOI 10.1074/jbc.M007632200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Velyvis, A.' 1 ? primary 'Yang, Y.' 2 ? primary 'Wu, C.' 3 ? primary 'Qin, J.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PINCH PROTEIN' 8852.071 1 ? ? 'LIM1 DOMAIN, RESIDUES 1-70' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PARTICULARLY INTERESTING NEW CYS-HIS PROTEIN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ISEFMANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPCWIL _entity_poly.pdbx_seq_one_letter_code_can ISEFMANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPCWIL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 SER n 1 3 GLU n 1 4 PHE n 1 5 MET n 1 6 ALA n 1 7 ASN n 1 8 ALA n 1 9 LEU n 1 10 ALA n 1 11 SER n 1 12 ALA n 1 13 THR n 1 14 CYS n 1 15 GLU n 1 16 ARG n 1 17 CYS n 1 18 LYS n 1 19 GLY n 1 20 GLY n 1 21 PHE n 1 22 ALA n 1 23 PRO n 1 24 ALA n 1 25 GLU n 1 26 LYS n 1 27 ILE n 1 28 VAL n 1 29 ASN n 1 30 SER n 1 31 ASN n 1 32 GLY n 1 33 GLU n 1 34 LEU n 1 35 TYR n 1 36 HIS n 1 37 GLU n 1 38 GLN n 1 39 CYS n 1 40 PHE n 1 41 VAL n 1 42 CYS n 1 43 ALA n 1 44 GLN n 1 45 CYS n 1 46 PHE n 1 47 GLN n 1 48 GLN n 1 49 PHE n 1 50 PRO n 1 51 GLU n 1 52 GLY n 1 53 LEU n 1 54 PHE n 1 55 TYR n 1 56 GLU n 1 57 PHE n 1 58 GLU n 1 59 GLY n 1 60 ARG n 1 61 LYS n 1 62 TYR n 1 63 CYS n 1 64 GLU n 1 65 HIS n 1 66 ASP n 1 67 PHE n 1 68 GLN n 1 69 MET n 1 70 LEU n 1 71 PHE n 1 72 ALA n 1 73 PRO n 1 74 CYS n 1 75 TRP n 1 76 ILE n 1 77 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene LIMS1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PMAL-C2X _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 -3 ? ? ? A . n A 1 2 SER 2 -2 ? ? ? A . n A 1 3 GLU 3 -1 ? ? ? A . n A 1 4 PHE 4 0 ? ? ? A . n A 1 5 MET 5 1 1 MET MET A . n A 1 6 ALA 6 2 2 ALA ALA A . n A 1 7 ASN 7 3 3 ASN ASN A . n A 1 8 ALA 8 4 4 ALA ALA A . n A 1 9 LEU 9 5 5 LEU LEU A . n A 1 10 ALA 10 6 6 ALA ALA A . n A 1 11 SER 11 7 7 SER SER A . n A 1 12 ALA 12 8 8 ALA ALA A . n A 1 13 THR 13 9 9 THR THR A . n A 1 14 CYS 14 10 10 CYS CYS A . n A 1 15 GLU 15 11 11 GLU GLU A . n A 1 16 ARG 16 12 12 ARG ARG A . n A 1 17 CYS 17 13 13 CYS CYS A . n A 1 18 LYS 18 14 14 LYS LYS A . n A 1 19 GLY 19 15 15 GLY GLY A . n A 1 20 GLY 20 16 16 GLY GLY A . n A 1 21 PHE 21 17 17 PHE PHE A . n A 1 22 ALA 22 18 18 ALA ALA A . n A 1 23 PRO 23 19 19 PRO PRO A . n A 1 24 ALA 24 20 20 ALA ALA A . n A 1 25 GLU 25 21 21 GLU GLU A . n A 1 26 LYS 26 22 22 LYS LYS A . n A 1 27 ILE 27 23 23 ILE ILE A . n A 1 28 VAL 28 24 24 VAL VAL A . n A 1 29 ASN 29 25 25 ASN ASN A . n A 1 30 SER 30 26 26 SER SER A . n A 1 31 ASN 31 27 27 ASN ASN A . n A 1 32 GLY 32 28 28 GLY GLY A . n A 1 33 GLU 33 29 29 GLU GLU A . n A 1 34 LEU 34 30 30 LEU LEU A . n A 1 35 TYR 35 31 31 TYR TYR A . n A 1 36 HIS 36 32 32 HIS HIS A . n A 1 37 GLU 37 33 33 GLU GLU A . n A 1 38 GLN 38 34 34 GLN GLN A . n A 1 39 CYS 39 35 35 CYS CYS A . n A 1 40 PHE 40 36 36 PHE PHE A . n A 1 41 VAL 41 37 37 VAL VAL A . n A 1 42 CYS 42 38 38 CYS CYS A . n A 1 43 ALA 43 39 39 ALA ALA A . n A 1 44 GLN 44 40 40 GLN GLN A . n A 1 45 CYS 45 41 41 CYS CYS A . n A 1 46 PHE 46 42 42 PHE PHE A . n A 1 47 GLN 47 43 43 GLN GLN A . n A 1 48 GLN 48 44 44 GLN GLN A . n A 1 49 PHE 49 45 45 PHE PHE A . n A 1 50 PRO 50 46 46 PRO PRO A . n A 1 51 GLU 51 47 47 GLU GLU A . n A 1 52 GLY 52 48 48 GLY GLY A . n A 1 53 LEU 53 49 49 LEU LEU A . n A 1 54 PHE 54 50 50 PHE PHE A . n A 1 55 TYR 55 51 51 TYR TYR A . n A 1 56 GLU 56 52 52 GLU GLU A . n A 1 57 PHE 57 53 53 PHE PHE A . n A 1 58 GLU 58 54 54 GLU GLU A . n A 1 59 GLY 59 55 55 GLY GLY A . n A 1 60 ARG 60 56 56 ARG ARG A . n A 1 61 LYS 61 57 57 LYS LYS A . n A 1 62 TYR 62 58 58 TYR TYR A . n A 1 63 CYS 63 59 59 CYS CYS A . n A 1 64 GLU 64 60 60 GLU GLU A . n A 1 65 HIS 65 61 61 HIS HIS A . n A 1 66 ASP 66 62 62 ASP ASP A . n A 1 67 PHE 67 63 63 PHE PHE A . n A 1 68 GLN 68 64 64 GLN GLN A . n A 1 69 MET 69 65 65 MET MET A . n A 1 70 LEU 70 66 66 LEU LEU A . n A 1 71 PHE 71 67 67 PHE PHE A . n A 1 72 ALA 72 68 68 ALA ALA A . n A 1 73 PRO 73 69 69 PRO PRO A . n A 1 74 CYS 74 70 70 CYS CYS A . n A 1 75 TRP 75 71 ? ? ? A . n A 1 76 ILE 76 72 ? ? ? A . n A 1 77 LEU 77 73 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 998 998 ZN ZN A . C 2 ZN 1 999 999 ZN ZN A . # _cell.entry_id 1G47 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1G47 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1G47 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1G47 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1G47 _struct.title '1ST LIM DOMAIN OF PINCH PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1G47 _struct_keywords.pdbx_keywords 'CELL ADHESION' _struct_keywords.text 'LIM domain; Zn finger, CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PINC_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P48059 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1G47 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 74 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P48059 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 70 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 70 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1G47 ILE A 1 ? UNP P48059 ? ? 'cloning artifact' -3 1 1 1G47 SER A 2 ? UNP P48059 ? ? 'cloning artifact' -2 2 1 1G47 GLU A 3 ? UNP P48059 ? ? 'cloning artifact' -1 3 1 1G47 PHE A 4 ? UNP P48059 ? ? 'cloning artifact' 0 4 1 1G47 TRP A 75 ? UNP P48059 ? ? 'cloning artifact' 71 5 1 1G47 ILE A 76 ? UNP P48059 ? ? 'cloning artifact' 72 6 1 1G47 LEU A 77 ? UNP P48059 ? ? 'cloning artifact' 73 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PHE A 49 ? LEU A 53 ? PHE A 45 LEU A 49 5 ? 5 HELX_P HELX_P2 2 CYS A 63 ? PHE A 71 ? CYS A 59 PHE A 67 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 14 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 10 A ZN 998 1_555 ? ? ? ? ? ? ? 2.300 ? ? metalc2 metalc ? ? A CYS 17 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 13 A ZN 998 1_555 ? ? ? ? ? ? ? 2.301 ? ? metalc3 metalc ? ? A HIS 36 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 32 A ZN 998 1_555 ? ? ? ? ? ? ? 1.997 ? ? metalc4 metalc ? ? A CYS 39 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 35 A ZN 998 1_555 ? ? ? ? ? ? ? 2.305 ? ? metalc5 metalc ? ? A CYS 42 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 38 A ZN 999 1_555 ? ? ? ? ? ? ? 2.306 ? ? metalc6 metalc ? ? A CYS 45 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 41 A ZN 999 1_555 ? ? ? ? ? ? ? 2.301 ? ? metalc7 metalc ? ? A CYS 63 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 59 A ZN 999 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc8 metalc ? ? A HIS 65 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 61 A ZN 999 1_555 ? ? ? ? ? ? ? 2.006 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 14 ? A CYS 10 ? 1_555 ZN ? B ZN . ? A ZN 998 ? 1_555 SG ? A CYS 17 ? A CYS 13 ? 1_555 115.0 ? 2 SG ? A CYS 14 ? A CYS 10 ? 1_555 ZN ? B ZN . ? A ZN 998 ? 1_555 ND1 ? A HIS 36 ? A HIS 32 ? 1_555 107.1 ? 3 SG ? A CYS 17 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 998 ? 1_555 ND1 ? A HIS 36 ? A HIS 32 ? 1_555 104.8 ? 4 SG ? A CYS 14 ? A CYS 10 ? 1_555 ZN ? B ZN . ? A ZN 998 ? 1_555 SG ? A CYS 39 ? A CYS 35 ? 1_555 108.1 ? 5 SG ? A CYS 17 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 998 ? 1_555 SG ? A CYS 39 ? A CYS 35 ? 1_555 113.5 ? 6 ND1 ? A HIS 36 ? A HIS 32 ? 1_555 ZN ? B ZN . ? A ZN 998 ? 1_555 SG ? A CYS 39 ? A CYS 35 ? 1_555 107.9 ? 7 SG ? A CYS 42 ? A CYS 38 ? 1_555 ZN ? C ZN . ? A ZN 999 ? 1_555 SG ? A CYS 45 ? A CYS 41 ? 1_555 103.5 ? 8 SG ? A CYS 42 ? A CYS 38 ? 1_555 ZN ? C ZN . ? A ZN 999 ? 1_555 SG ? A CYS 63 ? A CYS 59 ? 1_555 102.5 ? 9 SG ? A CYS 45 ? A CYS 41 ? 1_555 ZN ? C ZN . ? A ZN 999 ? 1_555 SG ? A CYS 63 ? A CYS 59 ? 1_555 115.8 ? 10 SG ? A CYS 42 ? A CYS 38 ? 1_555 ZN ? C ZN . ? A ZN 999 ? 1_555 ND1 ? A HIS 65 ? A HIS 61 ? 1_555 123.0 ? 11 SG ? A CYS 45 ? A CYS 41 ? 1_555 ZN ? C ZN . ? A ZN 999 ? 1_555 ND1 ? A HIS 65 ? A HIS 61 ? 1_555 97.3 ? 12 SG ? A CYS 63 ? A CYS 59 ? 1_555 ZN ? C ZN . ? A ZN 999 ? 1_555 ND1 ? A HIS 65 ? A HIS 61 ? 1_555 114.9 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 28 ? SER A 30 ? VAL A 24 SER A 26 A 2 GLU A 33 ? TYR A 35 ? GLU A 29 TYR A 31 B 1 TYR A 55 ? PHE A 57 ? TYR A 51 PHE A 53 B 2 ARG A 60 ? TYR A 62 ? ARG A 56 TYR A 58 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N SER A 30 ? N SER A 26 O GLU A 33 ? O GLU A 29 B 1 2 N PHE A 57 ? N PHE A 53 O ARG A 60 ? O ARG A 56 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 998 ? 4 'BINDING SITE FOR RESIDUE ZN A 998' AC2 Software A ZN 999 ? 4 'BINDING SITE FOR RESIDUE ZN A 999' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 14 ? CYS A 10 . ? 1_555 ? 2 AC1 4 CYS A 17 ? CYS A 13 . ? 1_555 ? 3 AC1 4 HIS A 36 ? HIS A 32 . ? 1_555 ? 4 AC1 4 CYS A 39 ? CYS A 35 . ? 1_555 ? 5 AC2 4 CYS A 42 ? CYS A 38 . ? 1_555 ? 6 AC2 4 CYS A 45 ? CYS A 41 . ? 1_555 ? 7 AC2 4 CYS A 63 ? CYS A 59 . ? 1_555 ? 8 AC2 4 HIS A 65 ? HIS A 61 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A VAL 24 ? ? H A TYR 31 ? ? 1.55 2 1 O A PRO 19 ? ? H A ILE 23 ? ? 1.57 3 2 O A VAL 24 ? ? H A TYR 31 ? ? 1.60 4 4 O A SER 26 ? ? H A GLU 29 ? ? 1.57 5 5 O A PRO 19 ? ? H A ILE 23 ? ? 1.58 6 5 HD21 A ASN 27 ? ? OH A TYR 31 ? ? 1.60 7 7 OG1 A THR 9 ? ? HZ2 A LYS 14 ? ? 1.56 8 9 O A PRO 19 ? ? H A ILE 23 ? ? 1.59 9 11 H A ALA 39 ? ? O A LYS 57 ? ? 1.58 10 12 O A PRO 19 ? ? H A ILE 23 ? ? 1.56 11 12 O A VAL 24 ? ? H A TYR 31 ? ? 1.56 12 13 O A PRO 19 ? ? H A ILE 23 ? ? 1.58 13 13 OG1 A THR 9 ? ? HZ3 A LYS 14 ? ? 1.58 14 13 O A SER 26 ? ? H A GLY 28 ? ? 1.58 15 14 O A VAL 24 ? ? H A TYR 31 ? ? 1.58 16 15 O A PRO 19 ? ? H A ILE 23 ? ? 1.57 17 16 H A ALA 39 ? ? O A LYS 57 ? ? 1.53 18 16 O A SER 26 ? ? H A GLY 28 ? ? 1.58 19 16 O A PRO 19 ? ? H A ILE 23 ? ? 1.59 20 17 O A VAL 24 ? ? H A TYR 31 ? ? 1.59 21 18 O A PRO 19 ? ? H A ILE 23 ? ? 1.57 22 19 O A VAL 24 ? ? H A TYR 31 ? ? 1.59 23 20 O A PRO 19 ? ? H A ILE 23 ? ? 1.56 24 21 HD21 A ASN 27 ? ? O A PHE 53 ? ? 1.54 25 22 O A SER 26 ? ? H A GLY 28 ? ? 1.56 26 22 O A PRO 19 ? ? H A ILE 23 ? ? 1.58 27 23 H A ALA 39 ? ? O A LYS 57 ? ? 1.59 28 25 O A PRO 19 ? ? H A ILE 23 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? 59.10 -160.24 2 1 ALA A 6 ? ? -75.61 -81.03 3 1 CYS A 13 ? ? -160.51 -25.23 4 1 ALA A 18 ? ? -175.39 -55.38 5 1 ASN A 27 ? ? 71.99 -44.19 6 1 GLN A 34 ? ? -152.93 44.31 7 1 PHE A 36 ? ? -42.57 108.11 8 1 GLN A 40 ? ? -104.82 -68.32 9 1 PRO A 46 ? ? -63.91 -150.76 10 1 GLU A 47 ? ? 70.64 -40.37 11 1 LEU A 49 ? ? -177.70 133.52 12 1 PHE A 50 ? ? -150.78 -130.92 13 1 TYR A 51 ? ? -93.31 57.47 14 1 GLU A 60 ? ? -66.84 6.51 15 1 HIS A 61 ? ? -81.27 -75.66 16 1 PHE A 67 ? ? 66.26 86.24 17 2 ALA A 8 ? ? 67.29 110.99 18 2 ALA A 18 ? ? -174.96 -56.29 19 2 ASN A 27 ? ? 71.75 -40.61 20 2 GLN A 34 ? ? -166.89 44.16 21 2 PHE A 36 ? ? -52.22 100.58 22 2 ALA A 39 ? ? -48.91 -17.66 23 2 GLN A 40 ? ? -108.97 -73.22 24 2 PRO A 46 ? ? -58.52 103.20 25 2 GLU A 47 ? ? 30.68 43.89 26 2 LEU A 49 ? ? 45.89 70.77 27 2 PHE A 50 ? ? -81.68 -125.75 28 2 TYR A 51 ? ? -102.14 58.59 29 2 LYS A 57 ? ? -171.44 131.85 30 2 PHE A 67 ? ? 62.67 75.87 31 3 LEU A 5 ? ? 69.86 130.31 32 3 ALA A 6 ? ? -159.66 -40.04 33 3 ALA A 18 ? ? -174.90 -55.51 34 3 SER A 26 ? ? -160.96 -113.77 35 3 ASN A 27 ? ? -40.11 73.26 36 3 GLN A 34 ? ? -152.35 48.99 37 3 PHE A 36 ? ? -38.29 115.00 38 3 ALA A 39 ? ? -55.80 -9.03 39 3 PRO A 46 ? ? -65.12 -154.13 40 3 GLU A 47 ? ? 70.91 -26.78 41 3 LEU A 49 ? ? -176.92 96.06 42 3 PHE A 50 ? ? -105.52 -117.34 43 3 TYR A 51 ? ? -98.98 45.26 44 3 GLU A 60 ? ? -68.91 10.70 45 3 HIS A 61 ? ? -86.08 -70.54 46 4 ALA A 4 ? ? -163.92 -44.61 47 4 SER A 7 ? ? -154.27 -86.03 48 4 CYS A 13 ? ? -158.43 -26.65 49 4 ALA A 18 ? ? -178.09 -53.18 50 4 ASN A 27 ? ? 46.69 29.91 51 4 GLN A 34 ? ? -150.83 47.80 52 4 PHE A 36 ? ? -48.72 104.03 53 4 GLN A 40 ? ? -100.09 -75.03 54 4 PHE A 42 ? ? 55.93 17.33 55 4 PRO A 46 ? ? -63.51 -169.04 56 4 PHE A 50 ? ? -67.32 -105.59 57 4 TYR A 51 ? ? -145.40 57.07 58 4 PHE A 67 ? ? 66.55 84.71 59 5 ASN A 3 ? ? -156.42 -33.12 60 5 ALA A 6 ? ? 53.39 -101.39 61 5 SER A 7 ? ? -156.13 -69.70 62 5 ALA A 18 ? ? -175.13 -55.05 63 5 ASN A 27 ? ? 72.31 -41.53 64 5 GLN A 34 ? ? -143.20 49.68 65 5 PHE A 36 ? ? -59.10 82.09 66 5 ALA A 39 ? ? -56.48 -6.92 67 5 PHE A 42 ? ? 38.32 29.33 68 5 LEU A 49 ? ? -175.87 87.15 69 5 PHE A 50 ? ? -108.08 -133.82 70 5 GLU A 60 ? ? -67.66 8.25 71 5 HIS A 61 ? ? -82.51 -71.94 72 5 PHE A 67 ? ? 164.45 -76.28 73 5 ALA A 68 ? ? -170.63 61.14 74 6 ALA A 2 ? ? -155.17 -66.52 75 6 ALA A 4 ? ? -88.28 -96.47 76 6 SER A 7 ? ? -167.61 118.02 77 6 ALA A 18 ? ? -176.40 -54.76 78 6 ASN A 27 ? ? 62.14 -0.11 79 6 GLN A 34 ? ? -143.58 50.24 80 6 PHE A 36 ? ? -45.59 107.53 81 6 ALA A 39 ? ? -59.00 -7.37 82 6 GLN A 40 ? ? -109.28 -66.00 83 6 PRO A 46 ? ? -65.53 0.70 84 6 LEU A 49 ? ? -176.19 83.81 85 6 PHE A 50 ? ? -89.22 -106.31 86 6 LYS A 57 ? ? -173.57 143.18 87 7 ALA A 2 ? ? 54.36 75.22 88 7 ALA A 4 ? ? -161.66 -46.46 89 7 ALA A 8 ? ? 63.83 99.95 90 7 CYS A 13 ? ? -161.29 -25.41 91 7 ALA A 18 ? ? -178.51 -54.77 92 7 ASN A 27 ? ? 64.35 -69.35 93 7 PHE A 36 ? ? -59.40 94.90 94 7 ALA A 39 ? ? -51.73 -7.42 95 7 GLN A 40 ? ? -109.32 -66.28 96 7 PHE A 42 ? ? 56.51 12.20 97 7 LEU A 49 ? ? -175.82 117.67 98 7 PHE A 50 ? ? -135.02 -121.58 99 7 TYR A 51 ? ? -107.14 58.20 100 7 ALA A 68 ? ? 54.22 74.10 101 8 ALA A 2 ? ? -156.48 -58.73 102 8 ASN A 3 ? ? -86.60 -138.61 103 8 SER A 7 ? ? 70.97 -44.06 104 8 ALA A 18 ? ? -175.36 -55.60 105 8 ASN A 27 ? ? 68.14 -44.66 106 8 GLN A 34 ? ? -147.31 51.41 107 8 ALA A 39 ? ? -58.65 -9.04 108 8 GLN A 40 ? ? -103.32 -66.51 109 8 PRO A 46 ? ? -64.77 3.28 110 8 LEU A 49 ? ? -174.04 103.33 111 8 PHE A 50 ? ? -86.38 -110.50 112 8 TYR A 51 ? ? -117.75 79.37 113 8 ALA A 68 ? ? 52.29 76.14 114 9 ALA A 6 ? ? 60.24 -159.36 115 9 SER A 7 ? ? -154.88 -21.75 116 9 ALA A 18 ? ? -176.67 -55.81 117 9 GLN A 34 ? ? -159.12 44.19 118 9 PHE A 36 ? ? -53.78 90.92 119 9 ALA A 39 ? ? -59.89 -7.76 120 9 PHE A 42 ? ? 55.65 17.86 121 9 GLU A 47 ? ? 72.75 -39.80 122 9 LEU A 49 ? ? -176.18 132.20 123 9 PHE A 50 ? ? -164.33 -145.82 124 9 PHE A 67 ? ? 178.50 -41.77 125 10 ALA A 6 ? ? -160.34 -25.39 126 10 ALA A 18 ? ? 178.87 -51.46 127 10 PRO A 19 ? ? -54.13 -91.39 128 10 ALA A 20 ? ? -169.61 -48.81 129 10 ASN A 27 ? ? 63.23 -77.29 130 10 CYS A 35 ? ? -141.83 -3.28 131 10 GLN A 40 ? ? -108.83 -67.78 132 10 PHE A 42 ? ? 55.18 17.34 133 10 PRO A 46 ? ? -60.07 -161.01 134 10 LEU A 49 ? ? 62.46 166.51 135 10 PHE A 50 ? ? -176.07 -126.75 136 10 TYR A 51 ? ? -119.89 50.39 137 10 GLU A 60 ? ? -49.48 -19.73 138 10 HIS A 61 ? ? -66.31 -70.55 139 10 PHE A 67 ? ? 59.04 71.82 140 11 ALA A 4 ? ? -80.40 -157.27 141 11 LEU A 5 ? ? -72.75 -165.40 142 11 ALA A 6 ? ? -63.10 96.41 143 11 ALA A 8 ? ? 69.99 125.48 144 11 ARG A 12 ? ? -149.18 -47.50 145 11 ALA A 18 ? ? 178.47 -52.04 146 11 PRO A 19 ? ? -53.75 -90.24 147 11 ALA A 20 ? ? -170.51 -45.94 148 11 ASN A 27 ? ? 59.98 -84.55 149 11 GLN A 34 ? ? -148.26 47.61 150 11 PHE A 36 ? ? -40.52 97.01 151 11 ALA A 39 ? ? -56.56 -5.88 152 11 LEU A 49 ? ? -176.72 94.46 153 11 PHE A 50 ? ? -109.65 -123.93 154 11 TYR A 51 ? ? -96.40 54.38 155 11 LYS A 57 ? ? -174.66 126.82 156 11 HIS A 61 ? ? -86.62 -72.14 157 11 PHE A 67 ? ? 62.59 86.32 158 12 ALA A 18 ? ? -174.39 -56.29 159 12 ASN A 27 ? ? 71.11 -35.08 160 12 GLN A 34 ? ? -165.33 47.91 161 12 PHE A 36 ? ? -43.34 94.95 162 12 ALA A 39 ? ? -59.76 -8.03 163 12 GLN A 40 ? ? -122.00 -63.95 164 12 PRO A 46 ? ? -62.58 16.40 165 12 LEU A 49 ? ? -177.48 89.68 166 12 PHE A 50 ? ? -88.61 -125.06 167 12 TYR A 51 ? ? -102.14 54.93 168 12 GLU A 60 ? ? -69.07 1.88 169 12 ALA A 68 ? ? 54.59 74.41 170 13 ALA A 4 ? ? 60.61 -170.06 171 13 ALA A 18 ? ? -176.15 -55.40 172 13 ASN A 27 ? ? 68.69 -47.59 173 13 PHE A 36 ? ? -41.48 105.06 174 13 GLN A 40 ? ? -107.07 -67.17 175 13 PHE A 42 ? ? 53.86 16.04 176 13 LEU A 49 ? ? -174.06 60.10 177 13 PHE A 50 ? ? -92.29 -110.77 178 13 LYS A 57 ? ? -174.02 128.91 179 13 PHE A 67 ? ? 68.76 89.88 180 14 ALA A 2 ? ? -154.36 -58.19 181 14 LEU A 5 ? ? 56.52 -161.68 182 14 ALA A 6 ? ? -158.31 53.18 183 14 CYS A 13 ? ? -161.16 -26.50 184 14 ALA A 18 ? ? -175.98 -56.57 185 14 ASN A 27 ? ? 71.95 -44.45 186 14 PHE A 36 ? ? -57.36 92.67 187 14 ALA A 39 ? ? -54.92 -8.31 188 14 PRO A 46 ? ? -64.92 -161.29 189 14 GLU A 47 ? ? 73.14 -42.43 190 14 LEU A 49 ? ? -177.92 124.95 191 14 PHE A 50 ? ? -145.67 -134.52 192 14 TYR A 51 ? ? -90.37 57.25 193 14 PHE A 67 ? ? 174.08 97.49 194 15 ALA A 18 ? ? -173.26 -55.43 195 15 ASN A 27 ? ? 65.94 -79.12 196 15 GLN A 34 ? ? -144.46 52.18 197 15 GLN A 40 ? ? -107.83 -69.83 198 15 PHE A 42 ? ? 57.26 15.24 199 15 PHE A 50 ? ? -83.25 -123.17 200 15 TYR A 51 ? ? -111.19 66.84 201 15 PRO A 69 ? ? -52.41 93.19 202 16 ASN A 3 ? ? -140.55 -13.31 203 16 LEU A 5 ? ? 60.75 92.18 204 16 ALA A 6 ? ? -149.72 -73.24 205 16 ALA A 18 ? ? -174.82 -54.35 206 16 ASN A 27 ? ? 68.78 -47.85 207 16 GLN A 34 ? ? -143.96 50.84 208 16 GLN A 40 ? ? -109.08 -65.17 209 16 PRO A 46 ? ? -61.19 -164.03 210 16 GLU A 47 ? ? 74.19 -42.77 211 16 PHE A 50 ? ? -176.31 -101.65 212 16 TYR A 51 ? ? -151.21 51.87 213 16 PHE A 67 ? ? 64.60 88.04 214 17 ALA A 2 ? ? -82.79 -140.94 215 17 ALA A 4 ? ? 59.71 -167.93 216 17 ALA A 18 ? ? -171.39 -56.87 217 17 ASN A 27 ? ? 71.60 -45.30 218 17 GLN A 34 ? ? -146.55 46.15 219 17 PHE A 36 ? ? -49.03 100.21 220 17 GLN A 40 ? ? -120.47 -65.86 221 17 PHE A 42 ? ? 56.88 17.09 222 17 GLU A 47 ? ? 71.77 -31.31 223 17 LEU A 49 ? ? -175.04 122.93 224 17 PHE A 50 ? ? -156.79 -145.29 225 17 PHE A 67 ? ? 168.22 99.34 226 18 ALA A 2 ? ? 62.72 -179.00 227 18 ALA A 6 ? ? 59.49 17.99 228 18 SER A 7 ? ? 58.59 -174.58 229 18 PHE A 17 ? ? -115.39 -169.87 230 18 ALA A 18 ? ? -175.69 -55.53 231 18 ASN A 27 ? ? 61.26 -86.29 232 18 GLN A 34 ? ? -141.64 51.98 233 18 PHE A 36 ? ? -44.36 106.45 234 18 LEU A 49 ? ? 179.53 93.68 235 18 PHE A 50 ? ? -113.56 -127.58 236 18 TYR A 51 ? ? -100.05 64.03 237 18 GLU A 54 ? ? -58.30 107.35 238 18 GLU A 60 ? ? -67.94 3.45 239 18 PHE A 67 ? ? 167.97 -76.37 240 18 ALA A 68 ? ? 174.38 -56.92 241 19 ASN A 3 ? ? -158.96 -51.87 242 19 ALA A 6 ? ? -163.78 -49.63 243 19 SER A 7 ? ? 62.85 -177.65 244 19 ALA A 18 ? ? -176.18 -54.96 245 19 ASN A 27 ? ? -35.89 96.94 246 19 GLU A 29 ? ? -163.06 -149.31 247 19 GLN A 34 ? ? -149.76 50.95 248 19 CYS A 35 ? ? -145.01 -6.11 249 19 PHE A 36 ? ? -56.78 97.72 250 19 ALA A 39 ? ? -58.86 -5.85 251 19 PHE A 50 ? ? -83.36 -117.87 252 19 TYR A 51 ? ? -119.95 64.23 253 19 LYS A 57 ? ? -173.62 133.15 254 19 GLU A 60 ? ? -68.11 9.24 255 19 HIS A 61 ? ? -83.09 -72.19 256 19 ALA A 68 ? ? 52.38 73.25 257 20 ALA A 6 ? ? 68.29 -1.07 258 20 SER A 7 ? ? 62.98 171.28 259 20 ALA A 18 ? ? -173.37 -55.76 260 20 ASN A 27 ? ? 70.10 -43.14 261 20 GLN A 34 ? ? -158.85 49.70 262 20 ALA A 39 ? ? -53.70 -8.56 263 20 PHE A 42 ? ? 58.12 17.17 264 20 PRO A 46 ? ? -58.13 109.90 265 20 GLU A 47 ? ? 30.54 48.51 266 20 LEU A 49 ? ? 62.88 105.25 267 20 PHE A 50 ? ? -122.87 -133.16 268 20 TYR A 51 ? ? -91.80 56.45 269 20 HIS A 61 ? ? -62.93 -71.20 270 20 PHE A 67 ? ? 64.21 87.26 271 21 ALA A 6 ? ? 62.88 -174.22 272 21 SER A 7 ? ? -152.48 22.69 273 21 ALA A 18 ? ? -175.89 -56.36 274 21 ASN A 27 ? ? 65.39 -8.76 275 21 PHE A 36 ? ? -42.72 94.02 276 21 PRO A 46 ? ? -64.35 -164.64 277 21 GLU A 47 ? ? 71.26 -9.53 278 21 LEU A 49 ? ? -175.44 145.83 279 21 PHE A 50 ? ? -159.85 -136.62 280 21 TYR A 51 ? ? -88.99 49.73 281 21 LYS A 57 ? ? -172.12 120.60 282 21 HIS A 61 ? ? -83.96 -73.93 283 21 ALA A 68 ? ? 51.72 73.05 284 21 PRO A 69 ? ? -62.21 98.28 285 22 ASN A 3 ? ? 63.23 -171.31 286 22 ALA A 6 ? ? 56.77 -152.49 287 22 SER A 7 ? ? -146.56 -62.43 288 22 ALA A 18 ? ? -176.51 -55.89 289 22 ASN A 27 ? ? 66.49 -45.95 290 22 GLN A 34 ? ? -149.11 51.42 291 22 CYS A 35 ? ? -145.35 -4.92 292 22 GLN A 40 ? ? -106.82 -66.79 293 22 PRO A 46 ? ? -58.14 105.90 294 22 GLU A 47 ? ? 30.05 49.05 295 22 PHE A 50 ? ? -76.88 -110.80 296 22 LYS A 57 ? ? -176.45 135.28 297 22 GLU A 60 ? ? -64.05 5.05 298 22 HIS A 61 ? ? -82.49 -73.27 299 22 LEU A 66 ? ? -71.37 -77.92 300 22 PHE A 67 ? ? -160.57 78.99 301 22 ALA A 68 ? ? -163.16 63.70 302 22 PRO A 69 ? ? -64.71 98.54 303 23 ALA A 2 ? ? 61.11 -164.84 304 23 ALA A 4 ? ? -158.53 7.17 305 23 SER A 7 ? ? 54.72 -161.82 306 23 PHE A 17 ? ? -109.70 -169.46 307 23 ALA A 18 ? ? -173.49 -55.46 308 23 ASN A 27 ? ? 71.77 -38.45 309 23 GLN A 34 ? ? -151.91 45.09 310 23 PHE A 36 ? ? -44.49 103.89 311 23 ALA A 39 ? ? -57.16 -8.43 312 23 GLN A 40 ? ? -108.18 -63.34 313 23 LEU A 49 ? ? -177.45 116.01 314 23 PHE A 50 ? ? -132.95 -124.43 315 23 TYR A 51 ? ? -95.89 48.32 316 23 GLU A 60 ? ? -69.44 10.43 317 23 HIS A 61 ? ? -84.17 -75.08 318 24 ALA A 6 ? ? -62.65 97.47 319 24 ARG A 12 ? ? -143.85 -47.07 320 24 ALA A 18 ? ? -175.48 -54.31 321 24 ASN A 27 ? ? 67.79 -68.73 322 24 GLN A 34 ? ? -155.12 47.50 323 24 PHE A 36 ? ? -42.58 95.19 324 24 PRO A 46 ? ? -65.73 6.62 325 24 LEU A 49 ? ? -177.32 87.91 326 24 PHE A 50 ? ? -87.01 -108.95 327 24 LYS A 57 ? ? -177.77 130.58 328 24 HIS A 61 ? ? -79.68 -72.11 329 24 PHE A 67 ? ? -83.10 43.41 330 24 ALA A 68 ? ? 53.74 74.52 331 25 ASN A 3 ? ? 68.74 -64.07 332 25 ALA A 6 ? ? 56.02 -88.85 333 25 SER A 7 ? ? 63.68 100.06 334 25 ALA A 8 ? ? 68.80 117.08 335 25 ALA A 18 ? ? -175.80 -55.76 336 25 ASN A 27 ? ? 62.79 -75.21 337 25 PHE A 36 ? ? -43.83 96.92 338 25 ALA A 39 ? ? -56.89 -5.05 339 25 PHE A 42 ? ? 58.15 15.44 340 25 PRO A 46 ? ? -62.60 -175.92 341 25 GLU A 47 ? ? 70.22 -38.37 342 25 LEU A 49 ? ? -174.05 117.91 343 25 PHE A 50 ? ? -151.72 -135.48 344 25 TYR A 51 ? ? -93.49 55.73 345 25 LYS A 57 ? ? -174.53 149.91 346 25 ALA A 68 ? ? 50.76 76.26 # _pdbx_nmr_ensemble.entry_id 1G47 _pdbx_nmr_ensemble.conformers_calculated_total_number 125 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1G47 _pdbx_nmr_representative.conformer_id 6 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.5mM LIM1; 50mM phosphate; 100mM NaCl; 0.5mM beta-mercaptoethanol' '90% H2O/10% D2O' 2 '0.5mM LIM1; 50mM phosphate; 100mM NaCl; 0.5mM beta-mercaptoethanol' '100% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N/13C-separated_NOESY 2 1 1 HNHA 3 2 1 '2D NOESY' # _pdbx_nmr_refine.entry_id 1G47 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 3.843 'structure solution' 'Brunger, A.' 1 X-PLOR 3.843 refinement 'Brunger, A.' 2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ILE -3 ? A ILE 1 2 1 Y 1 A SER -2 ? A SER 2 3 1 Y 1 A GLU -1 ? A GLU 3 4 1 Y 1 A PHE 0 ? A PHE 4 5 1 Y 1 A TRP 71 ? A TRP 75 6 1 Y 1 A ILE 72 ? A ILE 76 7 1 Y 1 A LEU 73 ? A LEU 77 8 2 Y 1 A ILE -3 ? A ILE 1 9 2 Y 1 A SER -2 ? A SER 2 10 2 Y 1 A GLU -1 ? A GLU 3 11 2 Y 1 A PHE 0 ? A PHE 4 12 2 Y 1 A TRP 71 ? A TRP 75 13 2 Y 1 A ILE 72 ? A ILE 76 14 2 Y 1 A LEU 73 ? A LEU 77 15 3 Y 1 A ILE -3 ? A ILE 1 16 3 Y 1 A SER -2 ? A SER 2 17 3 Y 1 A GLU -1 ? A GLU 3 18 3 Y 1 A PHE 0 ? A PHE 4 19 3 Y 1 A TRP 71 ? A TRP 75 20 3 Y 1 A ILE 72 ? A ILE 76 21 3 Y 1 A LEU 73 ? A LEU 77 22 4 Y 1 A ILE -3 ? A ILE 1 23 4 Y 1 A SER -2 ? A SER 2 24 4 Y 1 A GLU -1 ? A GLU 3 25 4 Y 1 A PHE 0 ? A PHE 4 26 4 Y 1 A TRP 71 ? A TRP 75 27 4 Y 1 A ILE 72 ? A ILE 76 28 4 Y 1 A LEU 73 ? A LEU 77 29 5 Y 1 A ILE -3 ? A ILE 1 30 5 Y 1 A SER -2 ? A SER 2 31 5 Y 1 A GLU -1 ? A GLU 3 32 5 Y 1 A PHE 0 ? A PHE 4 33 5 Y 1 A TRP 71 ? A TRP 75 34 5 Y 1 A ILE 72 ? A ILE 76 35 5 Y 1 A LEU 73 ? A LEU 77 36 6 Y 1 A ILE -3 ? A ILE 1 37 6 Y 1 A SER -2 ? A SER 2 38 6 Y 1 A GLU -1 ? A GLU 3 39 6 Y 1 A PHE 0 ? A PHE 4 40 6 Y 1 A TRP 71 ? A TRP 75 41 6 Y 1 A ILE 72 ? A ILE 76 42 6 Y 1 A LEU 73 ? A LEU 77 43 7 Y 1 A ILE -3 ? A ILE 1 44 7 Y 1 A SER -2 ? A SER 2 45 7 Y 1 A GLU -1 ? A GLU 3 46 7 Y 1 A PHE 0 ? A PHE 4 47 7 Y 1 A TRP 71 ? A TRP 75 48 7 Y 1 A ILE 72 ? A ILE 76 49 7 Y 1 A LEU 73 ? A LEU 77 50 8 Y 1 A ILE -3 ? A ILE 1 51 8 Y 1 A SER -2 ? A SER 2 52 8 Y 1 A GLU -1 ? A GLU 3 53 8 Y 1 A PHE 0 ? A PHE 4 54 8 Y 1 A TRP 71 ? A TRP 75 55 8 Y 1 A ILE 72 ? A ILE 76 56 8 Y 1 A LEU 73 ? A LEU 77 57 9 Y 1 A ILE -3 ? A ILE 1 58 9 Y 1 A SER -2 ? A SER 2 59 9 Y 1 A GLU -1 ? A GLU 3 60 9 Y 1 A PHE 0 ? A PHE 4 61 9 Y 1 A TRP 71 ? A TRP 75 62 9 Y 1 A ILE 72 ? A ILE 76 63 9 Y 1 A LEU 73 ? A LEU 77 64 10 Y 1 A ILE -3 ? A ILE 1 65 10 Y 1 A SER -2 ? A SER 2 66 10 Y 1 A GLU -1 ? A GLU 3 67 10 Y 1 A PHE 0 ? A PHE 4 68 10 Y 1 A TRP 71 ? A TRP 75 69 10 Y 1 A ILE 72 ? A ILE 76 70 10 Y 1 A LEU 73 ? A LEU 77 71 11 Y 1 A ILE -3 ? A ILE 1 72 11 Y 1 A SER -2 ? A SER 2 73 11 Y 1 A GLU -1 ? A GLU 3 74 11 Y 1 A PHE 0 ? A PHE 4 75 11 Y 1 A TRP 71 ? A TRP 75 76 11 Y 1 A ILE 72 ? A ILE 76 77 11 Y 1 A LEU 73 ? A LEU 77 78 12 Y 1 A ILE -3 ? A ILE 1 79 12 Y 1 A SER -2 ? A SER 2 80 12 Y 1 A GLU -1 ? A GLU 3 81 12 Y 1 A PHE 0 ? A PHE 4 82 12 Y 1 A TRP 71 ? A TRP 75 83 12 Y 1 A ILE 72 ? A ILE 76 84 12 Y 1 A LEU 73 ? A LEU 77 85 13 Y 1 A ILE -3 ? A ILE 1 86 13 Y 1 A SER -2 ? A SER 2 87 13 Y 1 A GLU -1 ? A GLU 3 88 13 Y 1 A PHE 0 ? A PHE 4 89 13 Y 1 A TRP 71 ? A TRP 75 90 13 Y 1 A ILE 72 ? A ILE 76 91 13 Y 1 A LEU 73 ? A LEU 77 92 14 Y 1 A ILE -3 ? A ILE 1 93 14 Y 1 A SER -2 ? A SER 2 94 14 Y 1 A GLU -1 ? A GLU 3 95 14 Y 1 A PHE 0 ? A PHE 4 96 14 Y 1 A TRP 71 ? A TRP 75 97 14 Y 1 A ILE 72 ? A ILE 76 98 14 Y 1 A LEU 73 ? A LEU 77 99 15 Y 1 A ILE -3 ? A ILE 1 100 15 Y 1 A SER -2 ? A SER 2 101 15 Y 1 A GLU -1 ? A GLU 3 102 15 Y 1 A PHE 0 ? A PHE 4 103 15 Y 1 A TRP 71 ? A TRP 75 104 15 Y 1 A ILE 72 ? A ILE 76 105 15 Y 1 A LEU 73 ? A LEU 77 106 16 Y 1 A ILE -3 ? A ILE 1 107 16 Y 1 A SER -2 ? A SER 2 108 16 Y 1 A GLU -1 ? A GLU 3 109 16 Y 1 A PHE 0 ? A PHE 4 110 16 Y 1 A TRP 71 ? A TRP 75 111 16 Y 1 A ILE 72 ? A ILE 76 112 16 Y 1 A LEU 73 ? A LEU 77 113 17 Y 1 A ILE -3 ? A ILE 1 114 17 Y 1 A SER -2 ? A SER 2 115 17 Y 1 A GLU -1 ? A GLU 3 116 17 Y 1 A PHE 0 ? A PHE 4 117 17 Y 1 A TRP 71 ? A TRP 75 118 17 Y 1 A ILE 72 ? A ILE 76 119 17 Y 1 A LEU 73 ? A LEU 77 120 18 Y 1 A ILE -3 ? A ILE 1 121 18 Y 1 A SER -2 ? A SER 2 122 18 Y 1 A GLU -1 ? A GLU 3 123 18 Y 1 A PHE 0 ? A PHE 4 124 18 Y 1 A TRP 71 ? A TRP 75 125 18 Y 1 A ILE 72 ? A ILE 76 126 18 Y 1 A LEU 73 ? A LEU 77 127 19 Y 1 A ILE -3 ? A ILE 1 128 19 Y 1 A SER -2 ? A SER 2 129 19 Y 1 A GLU -1 ? A GLU 3 130 19 Y 1 A PHE 0 ? A PHE 4 131 19 Y 1 A TRP 71 ? A TRP 75 132 19 Y 1 A ILE 72 ? A ILE 76 133 19 Y 1 A LEU 73 ? A LEU 77 134 20 Y 1 A ILE -3 ? A ILE 1 135 20 Y 1 A SER -2 ? A SER 2 136 20 Y 1 A GLU -1 ? A GLU 3 137 20 Y 1 A PHE 0 ? A PHE 4 138 20 Y 1 A TRP 71 ? A TRP 75 139 20 Y 1 A ILE 72 ? A ILE 76 140 20 Y 1 A LEU 73 ? A LEU 77 141 21 Y 1 A ILE -3 ? A ILE 1 142 21 Y 1 A SER -2 ? A SER 2 143 21 Y 1 A GLU -1 ? A GLU 3 144 21 Y 1 A PHE 0 ? A PHE 4 145 21 Y 1 A TRP 71 ? A TRP 75 146 21 Y 1 A ILE 72 ? A ILE 76 147 21 Y 1 A LEU 73 ? A LEU 77 148 22 Y 1 A ILE -3 ? A ILE 1 149 22 Y 1 A SER -2 ? A SER 2 150 22 Y 1 A GLU -1 ? A GLU 3 151 22 Y 1 A PHE 0 ? A PHE 4 152 22 Y 1 A TRP 71 ? A TRP 75 153 22 Y 1 A ILE 72 ? A ILE 76 154 22 Y 1 A LEU 73 ? A LEU 77 155 23 Y 1 A ILE -3 ? A ILE 1 156 23 Y 1 A SER -2 ? A SER 2 157 23 Y 1 A GLU -1 ? A GLU 3 158 23 Y 1 A PHE 0 ? A PHE 4 159 23 Y 1 A TRP 71 ? A TRP 75 160 23 Y 1 A ILE 72 ? A ILE 76 161 23 Y 1 A LEU 73 ? A LEU 77 162 24 Y 1 A ILE -3 ? A ILE 1 163 24 Y 1 A SER -2 ? A SER 2 164 24 Y 1 A GLU -1 ? A GLU 3 165 24 Y 1 A PHE 0 ? A PHE 4 166 24 Y 1 A TRP 71 ? A TRP 75 167 24 Y 1 A ILE 72 ? A ILE 76 168 24 Y 1 A LEU 73 ? A LEU 77 169 25 Y 1 A ILE -3 ? A ILE 1 170 25 Y 1 A SER -2 ? A SER 2 171 25 Y 1 A GLU -1 ? A GLU 3 172 25 Y 1 A PHE 0 ? A PHE 4 173 25 Y 1 A TRP 71 ? A TRP 75 174 25 Y 1 A ILE 72 ? A ILE 76 175 25 Y 1 A LEU 73 ? A LEU 77 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 ZN ZN ZN N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model UNITYPLUS _pdbx_nmr_spectrometer.field_strength 500 # _atom_sites.entry_id 1G47 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ #