data_1GB4 # _entry.id 1GB4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1GB4 pdb_00001gb4 10.2210/pdb1gb4/pdb WWPDB D_1000173489 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-07-22 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' struct_ref_seq_dif 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1GB4 _pdbx_database_status.recvd_initial_deposition_date 1998-01-19 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Malakauskas, S.M.' 1 'Mayo, S.L.' 2 # _citation.id primary _citation.title 'Design, structure and stability of a hyperthermophilic protein variant.' _citation.journal_abbrev Nat.Struct.Biol. _citation.journal_volume 5 _citation.page_first 470 _citation.page_last 475 _citation.year 1998 _citation.journal_id_ASTM NSBIEW _citation.country US _citation.journal_id_ISSN 1072-8368 _citation.journal_id_CSD 2024 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9628485 _citation.pdbx_database_id_DOI 10.1038/nsb0698-470 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Malakauskas, S.M.' 1 ? primary 'Mayo, S.L.' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description GB1-C3B4 _entity.formula_weight 6367.060 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'V1M, Y4F, V7I, T17I, T19I, T26E, V30I, V40I' _entity.pdbx_fragment 'B1 DOMAIN' _entity.details 'HYPERTHERMOPHILIC VARIANT OF THE B1 DOMAIN FROM STREPTOCOCCAL PROTEIN G' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MTTFKLIINGKTLKGEITIEAVDAAEAEKIFKQYANDNGIDGEWTYDDATKTFTVTE _entity_poly.pdbx_seq_one_letter_code_can MTTFKLIINGKTLKGEITIEAVDAAEAEKIFKQYANDNGIDGEWTYDDATKTFTVTE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 THR n 1 4 PHE n 1 5 LYS n 1 6 LEU n 1 7 ILE n 1 8 ILE n 1 9 ASN n 1 10 GLY n 1 11 LYS n 1 12 THR n 1 13 LEU n 1 14 LYS n 1 15 GLY n 1 16 GLU n 1 17 ILE n 1 18 THR n 1 19 ILE n 1 20 GLU n 1 21 ALA n 1 22 VAL n 1 23 ASP n 1 24 ALA n 1 25 ALA n 1 26 GLU n 1 27 ALA n 1 28 GLU n 1 29 LYS n 1 30 ILE n 1 31 PHE n 1 32 LYS n 1 33 GLN n 1 34 TYR n 1 35 ALA n 1 36 ASN n 1 37 ASP n 1 38 ASN n 1 39 GLY n 1 40 ILE n 1 41 ASP n 1 42 GLY n 1 43 GLU n 1 44 TRP n 1 45 THR n 1 46 TYR n 1 47 ASP n 1 48 ASP n 1 49 ALA n 1 50 THR n 1 51 LYS n 1 52 THR n 1 53 PHE n 1 54 THR n 1 55 VAL n 1 56 THR n 1 57 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Streptococcus _entity_src_gen.pdbx_gene_src_gene GB1C3B4 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain G148 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus sp.' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1324 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene GB1C3B4 _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector PET-11 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-GB1C3B4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 TRP 44 44 44 TRP TRP A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 GLU 57 57 57 GLU GLU A . n # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # _cell.entry_id 1GB4 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1GB4 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1GB4 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1GB4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1GB4 _struct.title 'HYPERTHERMOPHILIC VARIANT OF THE B1 DOMAIN FROM STREPTOCOCCAL PROTEIN G, NMR, 47 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1GB4 _struct_keywords.pdbx_keywords HYPERTHERMOPHILE _struct_keywords.text 'HYPERTHERMOPHILE, STREPTOCOCCAL PROTEIN G' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SPG2_STRSG _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P19909 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MEKEKKVKYFLRKSAFGLASVSAAFLVGSTVFAVDSPIEDTPIIRNGGELTNLLGNSETTLALRNEESATADLTAAAVAD TVAAAAAENAGAAAWEAAAAADALAKAKADALKEFNKYGVSDYYKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGL SDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYHKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGLSDFLK SQTPAEDTVKSIELAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALPKTDTYKLILNGKTLKGETTTE AVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKV FKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGV DGVWTYDDATKTFTVTEMVTEVPGDAPTEPEKPEASIPLVPLTPATPIAKDDAKKDDTKKEDAKKPEAKKEDAKKAETLP TTGEGSNPFFTAAALAVMAGAGALAVASKRKED ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1GB4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 57 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P19909 _struct_ref_seq.db_align_beg 372 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 427 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 57 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1GB4 PHE A 4 ? UNP P19909 TYR 374 'engineered mutation' 4 1 1 1GB4 ILE A 7 ? UNP P19909 VAL 377 'engineered mutation' 7 2 1 1GB4 ILE A 17 ? UNP P19909 THR 387 'engineered mutation' 17 3 1 1GB4 ILE A 19 ? UNP P19909 THR 389 'engineered mutation' 19 4 1 1GB4 GLU A 26 ? UNP P19909 THR 396 'engineered mutation' 26 5 1 1GB4 ILE A 30 ? UNP P19909 VAL 400 'engineered mutation' 30 6 1 1GB4 ILE A 40 ? UNP P19909 VAL 410 'engineered mutation' 40 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 23 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 38 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 23 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 38 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 13 ? ALA A 21 ? LEU A 13 ALA A 21 A 2 MET A 1 ? GLY A 10 ? MET A 1 GLY A 10 A 3 LYS A 51 ? GLU A 57 ? LYS A 51 GLU A 57 A 4 GLU A 43 ? ASP A 48 ? GLU A 43 ASP A 48 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 31 O A ILE 17 ? ? HG1 A THR 18 ? ? 1.57 2 35 O A GLN 33 ? ? H A ASP 37 ? ? 1.59 3 41 O A GLN 33 ? ? H A ASP 37 ? ? 1.60 4 45 O A GLN 33 ? ? H A ASP 37 ? ? 1.60 5 47 O A GLN 33 ? ? H A ASP 37 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 2 ? ? -104.78 74.69 2 1 LEU A 6 ? ? -164.25 107.59 3 1 ASN A 9 ? ? -103.51 67.74 4 1 LEU A 13 ? ? 58.32 163.74 5 1 LYS A 14 ? ? -177.24 88.93 6 2 THR A 3 ? ? -61.16 95.17 7 2 LEU A 6 ? ? -163.26 110.17 8 2 ASN A 9 ? ? -102.93 63.64 9 2 LYS A 11 ? ? -131.32 -40.84 10 2 LYS A 14 ? ? -172.34 86.08 11 3 ASN A 9 ? ? -104.95 67.06 12 3 LEU A 13 ? ? 60.33 127.82 13 4 THR A 2 ? ? -112.17 69.30 14 4 LYS A 5 ? ? -115.04 -168.35 15 4 LEU A 6 ? ? -166.20 107.37 16 4 THR A 12 ? ? -147.23 17.17 17 4 LEU A 13 ? ? -170.81 36.61 18 4 LYS A 14 ? ? -53.63 97.81 19 4 ILE A 17 ? ? 53.95 87.08 20 5 THR A 2 ? ? -104.81 41.14 21 5 THR A 3 ? ? -63.54 85.80 22 5 LEU A 13 ? ? 60.90 -76.69 23 5 LYS A 14 ? ? 54.99 99.91 24 5 THR A 18 ? ? 60.69 125.91 25 6 THR A 2 ? ? -136.61 -71.07 26 6 THR A 3 ? ? 49.86 86.31 27 6 LEU A 6 ? ? -164.43 112.65 28 6 THR A 12 ? ? -93.34 -147.58 29 6 LYS A 14 ? ? 50.90 99.38 30 6 ILE A 17 ? ? 52.36 74.66 31 7 THR A 2 ? ? -93.76 54.54 32 7 LEU A 6 ? ? -163.69 99.97 33 7 THR A 12 ? ? -82.63 -151.07 34 7 LYS A 14 ? ? 53.66 103.99 35 7 GLU A 16 ? ? -108.77 54.73 36 8 THR A 2 ? ? -106.40 42.93 37 8 THR A 3 ? ? -66.94 85.21 38 8 LYS A 14 ? ? -171.46 92.79 39 8 THR A 18 ? ? 46.32 98.18 40 9 THR A 2 ? ? -85.07 -72.88 41 9 THR A 3 ? ? 50.10 72.23 42 9 LYS A 14 ? ? -175.38 75.65 43 9 ILE A 17 ? ? 65.93 -60.46 44 9 THR A 18 ? ? 61.49 118.63 45 10 THR A 3 ? ? -62.91 94.73 46 10 LEU A 6 ? ? -163.13 97.92 47 10 LEU A 13 ? ? -172.69 -67.29 48 10 LYS A 14 ? ? 53.16 97.81 49 10 GLU A 16 ? ? -102.14 61.01 50 11 THR A 2 ? ? -125.49 -74.42 51 11 THR A 3 ? ? 50.24 79.77 52 11 LEU A 6 ? ? -163.08 105.68 53 11 THR A 12 ? ? -66.25 -78.21 54 11 LYS A 14 ? ? 56.69 114.44 55 11 TRP A 44 ? ? -164.10 112.33 56 12 THR A 2 ? ? -115.17 55.21 57 12 ASN A 9 ? ? -92.92 54.60 58 12 LYS A 11 ? ? -150.43 50.59 59 12 THR A 12 ? ? -138.72 -59.91 60 12 LYS A 14 ? ? 52.96 82.62 61 12 ILE A 17 ? ? 53.70 82.78 62 12 ASP A 41 ? ? -167.31 106.42 63 13 LEU A 6 ? ? -161.21 110.64 64 13 LYS A 11 ? ? -171.19 50.74 65 13 THR A 12 ? ? -140.20 23.80 66 13 LEU A 13 ? ? -177.61 -30.66 67 13 LYS A 14 ? ? 55.68 110.19 68 13 GLU A 16 ? ? -162.67 28.35 69 13 ASP A 41 ? ? -152.16 71.63 70 13 PHE A 53 ? ? -102.17 -169.33 71 14 THR A 2 ? ? -104.26 40.57 72 14 LEU A 6 ? ? -160.47 109.14 73 14 ASN A 9 ? ? -101.49 53.47 74 14 LYS A 11 ? ? -166.34 47.52 75 14 THR A 12 ? ? -140.54 -45.70 76 14 LYS A 14 ? ? 52.84 89.60 77 14 ASP A 41 ? ? -169.68 100.03 78 15 THR A 3 ? ? -63.27 95.08 79 15 LEU A 13 ? ? 61.59 -75.43 80 15 LYS A 14 ? ? 55.40 97.71 81 15 ILE A 17 ? ? 52.94 86.05 82 16 THR A 2 ? ? -104.23 -75.31 83 16 THR A 3 ? ? 50.17 78.01 84 16 LEU A 6 ? ? -160.77 102.79 85 16 LYS A 14 ? ? -33.74 137.25 86 16 GLU A 16 ? ? -140.82 47.57 87 16 ASP A 41 ? ? -162.33 101.97 88 17 LYS A 5 ? ? -107.23 -168.01 89 17 LEU A 6 ? ? -163.56 100.85 90 17 ASP A 41 ? ? -168.12 98.16 91 18 LEU A 6 ? ? -163.42 108.41 92 18 ASN A 9 ? ? -96.65 50.77 93 18 LYS A 11 ? ? -161.47 47.12 94 18 THR A 12 ? ? -136.45 -62.31 95 18 LYS A 14 ? ? 51.99 81.85 96 18 ASP A 41 ? ? -167.17 104.44 97 19 THR A 2 ? ? -98.26 45.97 98 19 LEU A 6 ? ? -162.21 112.35 99 19 LEU A 13 ? ? 59.36 159.10 100 20 LEU A 6 ? ? -164.34 118.16 101 20 LEU A 13 ? ? 56.09 169.04 102 20 LYS A 14 ? ? -179.64 90.80 103 20 ILE A 17 ? ? 53.65 85.41 104 21 THR A 2 ? ? -104.56 54.25 105 21 LEU A 6 ? ? -166.80 108.92 106 21 LYS A 11 ? ? -133.20 -41.23 107 21 THR A 12 ? ? -63.16 99.61 108 21 LEU A 13 ? ? 61.57 150.83 109 21 LYS A 14 ? ? -162.69 105.91 110 21 GLU A 16 ? ? -97.08 58.45 111 22 LYS A 5 ? ? -115.90 -164.06 112 22 LEU A 6 ? ? -168.12 108.51 113 22 LYS A 11 ? ? -153.32 23.66 114 22 LEU A 13 ? ? -172.32 32.16 115 22 LYS A 14 ? ? -52.60 103.82 116 22 ILE A 40 ? ? -102.41 74.61 117 22 ASP A 41 ? ? -75.95 -164.43 118 22 THR A 54 ? ? -160.96 117.76 119 23 ASN A 9 ? ? -101.21 75.94 120 23 LEU A 13 ? ? 62.80 136.89 121 23 THR A 18 ? ? 45.53 96.40 122 24 THR A 2 ? ? -103.13 -82.69 123 24 THR A 3 ? ? 50.24 90.64 124 24 LEU A 13 ? ? 41.00 27.05 125 24 GLU A 16 ? ? -140.48 42.42 126 24 ASP A 41 ? ? -167.61 97.63 127 25 LYS A 5 ? ? -113.24 -167.53 128 25 LEU A 6 ? ? -167.33 100.38 129 25 ASN A 9 ? ? -80.75 -158.96 130 25 LYS A 11 ? ? -148.07 25.54 131 25 LEU A 13 ? ? 67.43 -51.20 132 25 LYS A 14 ? ? 49.17 96.07 133 25 TRP A 44 ? ? -162.85 118.78 134 26 THR A 3 ? ? -60.12 92.02 135 26 LEU A 6 ? ? -160.08 112.43 136 26 LEU A 13 ? ? 60.90 -76.78 137 26 LYS A 14 ? ? 54.72 98.95 138 27 LEU A 6 ? ? -167.65 110.14 139 27 LEU A 13 ? ? 60.90 -77.30 140 27 LYS A 14 ? ? 54.37 92.81 141 27 ILE A 17 ? ? 53.60 72.75 142 28 THR A 2 ? ? -141.37 -69.24 143 28 THR A 3 ? ? 51.03 88.05 144 28 LEU A 6 ? ? -160.98 108.97 145 28 LEU A 13 ? ? -121.96 -54.09 146 28 LYS A 14 ? ? 52.66 82.63 147 28 ILE A 17 ? ? 54.12 83.41 148 28 ASP A 41 ? ? -172.18 94.34 149 28 TRP A 44 ? ? -163.41 116.56 150 29 LYS A 5 ? ? -105.88 -166.21 151 29 LEU A 6 ? ? -166.55 105.69 152 29 LEU A 13 ? ? 59.71 -78.06 153 29 LYS A 14 ? ? 56.30 100.43 154 29 ASP A 41 ? ? -169.90 104.49 155 30 LEU A 6 ? ? -165.04 108.63 156 30 ASN A 9 ? ? -98.88 40.96 157 30 LEU A 13 ? ? 62.25 144.09 158 30 ILE A 17 ? ? 53.25 95.25 159 31 THR A 3 ? ? -68.86 85.31 160 31 LYS A 11 ? ? -166.28 47.57 161 31 LYS A 14 ? ? -46.97 109.00 162 31 ILE A 17 ? ? 67.05 -61.38 163 31 THR A 18 ? ? 62.37 112.63 164 32 THR A 3 ? ? -67.16 91.31 165 32 LEU A 6 ? ? -160.57 102.48 166 32 LYS A 14 ? ? 37.35 101.52 167 32 ASP A 41 ? ? -168.10 106.61 168 32 TRP A 44 ? ? -162.65 116.06 169 32 THR A 56 ? ? -160.11 -169.44 170 33 THR A 3 ? ? -62.75 86.89 171 33 LEU A 6 ? ? -163.14 118.58 172 33 ASN A 9 ? ? -102.64 56.76 173 33 LEU A 13 ? ? 60.28 156.33 174 33 LYS A 14 ? ? -171.67 126.19 175 33 THR A 18 ? ? 45.33 97.23 176 33 ILE A 40 ? ? -100.50 57.89 177 34 THR A 3 ? ? -69.59 87.60 178 34 LEU A 13 ? ? 61.77 137.05 179 34 ILE A 17 ? ? 53.86 73.38 180 35 LYS A 5 ? ? -112.55 -167.30 181 35 LEU A 6 ? ? -166.44 108.60 182 35 ASN A 9 ? ? -105.07 57.90 183 35 LYS A 14 ? ? -176.42 80.37 184 36 ASN A 9 ? ? -117.54 73.31 185 36 LYS A 11 ? ? -149.97 -41.10 186 36 LYS A 14 ? ? -175.32 75.15 187 36 THR A 18 ? ? 54.58 110.38 188 37 THR A 3 ? ? -62.55 87.59 189 37 LEU A 13 ? ? 65.77 -53.62 190 37 LYS A 14 ? ? 43.79 95.68 191 37 THR A 18 ? ? 44.14 96.36 192 38 THR A 3 ? ? -67.79 93.00 193 38 LEU A 6 ? ? -165.32 104.86 194 38 ASN A 9 ? ? -81.68 -159.04 195 38 THR A 12 ? ? -58.02 94.98 196 38 LEU A 13 ? ? 58.17 171.03 197 38 LYS A 14 ? ? -162.69 106.90 198 38 ILE A 17 ? ? 54.09 76.24 199 38 ASP A 41 ? ? -171.19 100.26 200 38 TRP A 44 ? ? -163.92 108.53 201 39 THR A 12 ? ? -60.07 -164.64 202 39 LYS A 14 ? ? 52.33 101.22 203 39 THR A 18 ? ? 60.31 128.55 204 39 ASP A 41 ? ? -169.74 106.05 205 40 ASN A 9 ? ? -83.14 -157.97 206 40 LYS A 11 ? ? -144.65 25.71 207 40 THR A 12 ? ? -62.82 -71.77 208 40 LYS A 14 ? ? 54.28 100.67 209 40 ILE A 17 ? ? 65.52 -58.92 210 40 THR A 18 ? ? 57.50 107.53 211 40 ASP A 41 ? ? -172.18 103.58 212 40 TRP A 44 ? ? -161.24 115.22 213 40 THR A 50 ? ? -140.81 16.85 214 41 THR A 2 ? ? -82.74 -71.18 215 41 THR A 3 ? ? 49.69 76.84 216 41 THR A 18 ? ? 52.67 107.11 217 41 ASP A 41 ? ? -176.65 -165.99 218 41 VAL A 55 ? ? -164.35 96.40 219 42 LYS A 11 ? ? -154.64 30.39 220 42 LEU A 13 ? ? 67.31 -52.45 221 42 LYS A 14 ? ? 48.83 91.28 222 42 THR A 18 ? ? 47.01 102.20 223 43 THR A 12 ? ? -140.07 27.32 224 43 LEU A 13 ? ? -173.73 -74.55 225 43 GLU A 16 ? ? -111.99 64.87 226 43 PHE A 53 ? ? -62.30 -177.04 227 44 LEU A 13 ? ? 58.48 162.68 228 44 LYS A 14 ? ? -175.69 94.29 229 44 THR A 18 ? ? 61.83 129.59 230 45 THR A 3 ? ? -69.68 91.93 231 45 LEU A 6 ? ? -164.05 98.77 232 45 LEU A 13 ? ? 38.74 28.57 233 45 ILE A 17 ? ? 36.98 83.92 234 46 THR A 2 ? ? -110.57 -80.85 235 46 THR A 3 ? ? 52.39 97.46 236 46 ASN A 9 ? ? -108.84 52.29 237 46 LYS A 14 ? ? -174.04 76.21 238 46 GLU A 16 ? ? -67.06 -154.34 239 46 ILE A 17 ? ? -175.07 -32.25 240 46 THR A 18 ? ? 63.49 137.00 241 46 GLU A 20 ? ? -116.41 78.52 242 46 ASP A 41 ? ? -170.07 101.97 243 47 LEU A 6 ? ? -165.25 107.70 244 47 LEU A 13 ? ? 61.09 148.97 245 47 THR A 18 ? ? 56.79 112.54 # _pdbx_nmr_ensemble.entry_id 1GB4 _pdbx_nmr_ensemble.conformers_calculated_total_number 75 _pdbx_nmr_ensemble.conformers_submitted_total_number 47 _pdbx_nmr_ensemble.conformer_selection_criteria 'NO RESTRAINT VIOLATIONS GREATER THAN 0.3 ANGSTROMS' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents H2O/D2O # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure ATMOSPHERIC _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50mM _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type 'DQF-COSY NOESY TOCSY' _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_refine.entry_id 1GB4 _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' ANSIG ? ? 2 'structure solution' 'VARIAN VNMR' VNMR ? 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 ILE N N N N 96 ILE CA C N S 97 ILE C C N N 98 ILE O O N N 99 ILE CB C N S 100 ILE CG1 C N N 101 ILE CG2 C N N 102 ILE CD1 C N N 103 ILE OXT O N N 104 ILE H H N N 105 ILE H2 H N N 106 ILE HA H N N 107 ILE HB H N N 108 ILE HG12 H N N 109 ILE HG13 H N N 110 ILE HG21 H N N 111 ILE HG22 H N N 112 ILE HG23 H N N 113 ILE HD11 H N N 114 ILE HD12 H N N 115 ILE HD13 H N N 116 ILE HXT H N N 117 LEU N N N N 118 LEU CA C N S 119 LEU C C N N 120 LEU O O N N 121 LEU CB C N N 122 LEU CG C N N 123 LEU CD1 C N N 124 LEU CD2 C N N 125 LEU OXT O N N 126 LEU H H N N 127 LEU H2 H N N 128 LEU HA H N N 129 LEU HB2 H N N 130 LEU HB3 H N N 131 LEU HG H N N 132 LEU HD11 H N N 133 LEU HD12 H N N 134 LEU HD13 H N N 135 LEU HD21 H N N 136 LEU HD22 H N N 137 LEU HD23 H N N 138 LEU HXT H N N 139 LYS N N N N 140 LYS CA C N S 141 LYS C C N N 142 LYS O O N N 143 LYS CB C N N 144 LYS CG C N N 145 LYS CD C N N 146 LYS CE C N N 147 LYS NZ N N N 148 LYS OXT O N N 149 LYS H H N N 150 LYS H2 H N N 151 LYS HA H N N 152 LYS HB2 H N N 153 LYS HB3 H N N 154 LYS HG2 H N N 155 LYS HG3 H N N 156 LYS HD2 H N N 157 LYS HD3 H N N 158 LYS HE2 H N N 159 LYS HE3 H N N 160 LYS HZ1 H N N 161 LYS HZ2 H N N 162 LYS HZ3 H N N 163 LYS HXT H N N 164 MET N N N N 165 MET CA C N S 166 MET C C N N 167 MET O O N N 168 MET CB C N N 169 MET CG C N N 170 MET SD S N N 171 MET CE C N N 172 MET OXT O N N 173 MET H H N N 174 MET H2 H N N 175 MET HA H N N 176 MET HB2 H N N 177 MET HB3 H N N 178 MET HG2 H N N 179 MET HG3 H N N 180 MET HE1 H N N 181 MET HE2 H N N 182 MET HE3 H N N 183 MET HXT H N N 184 PHE N N N N 185 PHE CA C N S 186 PHE C C N N 187 PHE O O N N 188 PHE CB C N N 189 PHE CG C Y N 190 PHE CD1 C Y N 191 PHE CD2 C Y N 192 PHE CE1 C Y N 193 PHE CE2 C Y N 194 PHE CZ C Y N 195 PHE OXT O N N 196 PHE H H N N 197 PHE H2 H N N 198 PHE HA H N N 199 PHE HB2 H N N 200 PHE HB3 H N N 201 PHE HD1 H N N 202 PHE HD2 H N N 203 PHE HE1 H N N 204 PHE HE2 H N N 205 PHE HZ H N N 206 PHE HXT H N N 207 THR N N N N 208 THR CA C N S 209 THR C C N N 210 THR O O N N 211 THR CB C N R 212 THR OG1 O N N 213 THR CG2 C N N 214 THR OXT O N N 215 THR H H N N 216 THR H2 H N N 217 THR HA H N N 218 THR HB H N N 219 THR HG1 H N N 220 THR HG21 H N N 221 THR HG22 H N N 222 THR HG23 H N N 223 THR HXT H N N 224 TRP N N N N 225 TRP CA C N S 226 TRP C C N N 227 TRP O O N N 228 TRP CB C N N 229 TRP CG C Y N 230 TRP CD1 C Y N 231 TRP CD2 C Y N 232 TRP NE1 N Y N 233 TRP CE2 C Y N 234 TRP CE3 C Y N 235 TRP CZ2 C Y N 236 TRP CZ3 C Y N 237 TRP CH2 C Y N 238 TRP OXT O N N 239 TRP H H N N 240 TRP H2 H N N 241 TRP HA H N N 242 TRP HB2 H N N 243 TRP HB3 H N N 244 TRP HD1 H N N 245 TRP HE1 H N N 246 TRP HE3 H N N 247 TRP HZ2 H N N 248 TRP HZ3 H N N 249 TRP HH2 H N N 250 TRP HXT H N N 251 TYR N N N N 252 TYR CA C N S 253 TYR C C N N 254 TYR O O N N 255 TYR CB C N N 256 TYR CG C Y N 257 TYR CD1 C Y N 258 TYR CD2 C Y N 259 TYR CE1 C Y N 260 TYR CE2 C Y N 261 TYR CZ C Y N 262 TYR OH O N N 263 TYR OXT O N N 264 TYR H H N N 265 TYR H2 H N N 266 TYR HA H N N 267 TYR HB2 H N N 268 TYR HB3 H N N 269 TYR HD1 H N N 270 TYR HD2 H N N 271 TYR HE1 H N N 272 TYR HE2 H N N 273 TYR HH H N N 274 TYR HXT H N N 275 VAL N N N N 276 VAL CA C N S 277 VAL C C N N 278 VAL O O N N 279 VAL CB C N N 280 VAL CG1 C N N 281 VAL CG2 C N N 282 VAL OXT O N N 283 VAL H H N N 284 VAL H2 H N N 285 VAL HA H N N 286 VAL HB H N N 287 VAL HG11 H N N 288 VAL HG12 H N N 289 VAL HG13 H N N 290 VAL HG21 H N N 291 VAL HG22 H N N 292 VAL HG23 H N N 293 VAL HXT H N N 294 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 ILE N CA sing N N 90 ILE N H sing N N 91 ILE N H2 sing N N 92 ILE CA C sing N N 93 ILE CA CB sing N N 94 ILE CA HA sing N N 95 ILE C O doub N N 96 ILE C OXT sing N N 97 ILE CB CG1 sing N N 98 ILE CB CG2 sing N N 99 ILE CB HB sing N N 100 ILE CG1 CD1 sing N N 101 ILE CG1 HG12 sing N N 102 ILE CG1 HG13 sing N N 103 ILE CG2 HG21 sing N N 104 ILE CG2 HG22 sing N N 105 ILE CG2 HG23 sing N N 106 ILE CD1 HD11 sing N N 107 ILE CD1 HD12 sing N N 108 ILE CD1 HD13 sing N N 109 ILE OXT HXT sing N N 110 LEU N CA sing N N 111 LEU N H sing N N 112 LEU N H2 sing N N 113 LEU CA C sing N N 114 LEU CA CB sing N N 115 LEU CA HA sing N N 116 LEU C O doub N N 117 LEU C OXT sing N N 118 LEU CB CG sing N N 119 LEU CB HB2 sing N N 120 LEU CB HB3 sing N N 121 LEU CG CD1 sing N N 122 LEU CG CD2 sing N N 123 LEU CG HG sing N N 124 LEU CD1 HD11 sing N N 125 LEU CD1 HD12 sing N N 126 LEU CD1 HD13 sing N N 127 LEU CD2 HD21 sing N N 128 LEU CD2 HD22 sing N N 129 LEU CD2 HD23 sing N N 130 LEU OXT HXT sing N N 131 LYS N CA sing N N 132 LYS N H sing N N 133 LYS N H2 sing N N 134 LYS CA C sing N N 135 LYS CA CB sing N N 136 LYS CA HA sing N N 137 LYS C O doub N N 138 LYS C OXT sing N N 139 LYS CB CG sing N N 140 LYS CB HB2 sing N N 141 LYS CB HB3 sing N N 142 LYS CG CD sing N N 143 LYS CG HG2 sing N N 144 LYS CG HG3 sing N N 145 LYS CD CE sing N N 146 LYS CD HD2 sing N N 147 LYS CD HD3 sing N N 148 LYS CE NZ sing N N 149 LYS CE HE2 sing N N 150 LYS CE HE3 sing N N 151 LYS NZ HZ1 sing N N 152 LYS NZ HZ2 sing N N 153 LYS NZ HZ3 sing N N 154 LYS OXT HXT sing N N 155 MET N CA sing N N 156 MET N H sing N N 157 MET N H2 sing N N 158 MET CA C sing N N 159 MET CA CB sing N N 160 MET CA HA sing N N 161 MET C O doub N N 162 MET C OXT sing N N 163 MET CB CG sing N N 164 MET CB HB2 sing N N 165 MET CB HB3 sing N N 166 MET CG SD sing N N 167 MET CG HG2 sing N N 168 MET CG HG3 sing N N 169 MET SD CE sing N N 170 MET CE HE1 sing N N 171 MET CE HE2 sing N N 172 MET CE HE3 sing N N 173 MET OXT HXT sing N N 174 PHE N CA sing N N 175 PHE N H sing N N 176 PHE N H2 sing N N 177 PHE CA C sing N N 178 PHE CA CB sing N N 179 PHE CA HA sing N N 180 PHE C O doub N N 181 PHE C OXT sing N N 182 PHE CB CG sing N N 183 PHE CB HB2 sing N N 184 PHE CB HB3 sing N N 185 PHE CG CD1 doub Y N 186 PHE CG CD2 sing Y N 187 PHE CD1 CE1 sing Y N 188 PHE CD1 HD1 sing N N 189 PHE CD2 CE2 doub Y N 190 PHE CD2 HD2 sing N N 191 PHE CE1 CZ doub Y N 192 PHE CE1 HE1 sing N N 193 PHE CE2 CZ sing Y N 194 PHE CE2 HE2 sing N N 195 PHE CZ HZ sing N N 196 PHE OXT HXT sing N N 197 THR N CA sing N N 198 THR N H sing N N 199 THR N H2 sing N N 200 THR CA C sing N N 201 THR CA CB sing N N 202 THR CA HA sing N N 203 THR C O doub N N 204 THR C OXT sing N N 205 THR CB OG1 sing N N 206 THR CB CG2 sing N N 207 THR CB HB sing N N 208 THR OG1 HG1 sing N N 209 THR CG2 HG21 sing N N 210 THR CG2 HG22 sing N N 211 THR CG2 HG23 sing N N 212 THR OXT HXT sing N N 213 TRP N CA sing N N 214 TRP N H sing N N 215 TRP N H2 sing N N 216 TRP CA C sing N N 217 TRP CA CB sing N N 218 TRP CA HA sing N N 219 TRP C O doub N N 220 TRP C OXT sing N N 221 TRP CB CG sing N N 222 TRP CB HB2 sing N N 223 TRP CB HB3 sing N N 224 TRP CG CD1 doub Y N 225 TRP CG CD2 sing Y N 226 TRP CD1 NE1 sing Y N 227 TRP CD1 HD1 sing N N 228 TRP CD2 CE2 doub Y N 229 TRP CD2 CE3 sing Y N 230 TRP NE1 CE2 sing Y N 231 TRP NE1 HE1 sing N N 232 TRP CE2 CZ2 sing Y N 233 TRP CE3 CZ3 doub Y N 234 TRP CE3 HE3 sing N N 235 TRP CZ2 CH2 doub Y N 236 TRP CZ2 HZ2 sing N N 237 TRP CZ3 CH2 sing Y N 238 TRP CZ3 HZ3 sing N N 239 TRP CH2 HH2 sing N N 240 TRP OXT HXT sing N N 241 TYR N CA sing N N 242 TYR N H sing N N 243 TYR N H2 sing N N 244 TYR CA C sing N N 245 TYR CA CB sing N N 246 TYR CA HA sing N N 247 TYR C O doub N N 248 TYR C OXT sing N N 249 TYR CB CG sing N N 250 TYR CB HB2 sing N N 251 TYR CB HB3 sing N N 252 TYR CG CD1 doub Y N 253 TYR CG CD2 sing Y N 254 TYR CD1 CE1 sing Y N 255 TYR CD1 HD1 sing N N 256 TYR CD2 CE2 doub Y N 257 TYR CD2 HD2 sing N N 258 TYR CE1 CZ doub Y N 259 TYR CE1 HE1 sing N N 260 TYR CE2 CZ sing Y N 261 TYR CE2 HE2 sing N N 262 TYR CZ OH sing N N 263 TYR OH HH sing N N 264 TYR OXT HXT sing N N 265 VAL N CA sing N N 266 VAL N H sing N N 267 VAL N H2 sing N N 268 VAL CA C sing N N 269 VAL CA CB sing N N 270 VAL CA HA sing N N 271 VAL C O doub N N 272 VAL C OXT sing N N 273 VAL CB CG1 sing N N 274 VAL CB CG2 sing N N 275 VAL CB HB sing N N 276 VAL CG1 HG11 sing N N 277 VAL CG1 HG12 sing N N 278 VAL CG1 HG13 sing N N 279 VAL CG2 HG21 sing N N 280 VAL CG2 HG22 sing N N 281 VAL CG2 HG23 sing N N 282 VAL OXT HXT sing N N 283 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model UNITYPLUS _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1GB4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_