data_1GDC # _entry.id 1GDC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1GDC pdb_00001gdc 10.2210/pdb1gdc/pdb WWPDB D_1000173527 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2GDA _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1GDC _pdbx_database_status.recvd_initial_deposition_date 1994-03-15 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Baumann, H.' 1 'Paulsen, K.' 2 'Kovacs, H.' 3 'Berglund, H.' 4 'Wright, A.P.H.' 5 'Gustafsson, J.-A.' 6 'Hard, T.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Refined solution structure of the glucocorticoid receptor DNA-binding domain.' Biochemistry 32 13463 13471 1993 BICHAW US 0006-2960 0033 ? 8257681 10.1021/bi00212a011 1 ;Structure and Function of the DNA-Binding Domain of the Glucocorticoid Receptor and Other Members of the Nuclear Receptor Supergene Family ; Acc.Chem.Res. 26 644 ? 1993 ACHRE4 US 0001-4842 0411 ? ? ? 2 'Backbone Dynamics of the Glucocorticoid Receptor DNA-Binding Domain' Biochemistry 31 12001 ? 1992 BICHAW US 0006-2960 0033 ? ? ? 3 'Crystallographic Analysis of the Interaction of the Glucocorticoid Receptor with DNA' Nature 352 497 ? 1991 NATUAS UK 0028-0836 0006 ? ? ? 4 ;1H NMR Studies of the Glucocorticoid Receptor DNA-Binding Domain: Sequential Assignments and Identification of Secondary Structure Elements ; Biochemistry 29 9015 ? 1990 BICHAW US 0006-2960 0033 ? ? ? 5 'Solution Structure of the Glucocorticoid Receptor DNA-Binding Domain' Science 249 157 ? 1990 SCIEAS US 0036-8075 0038 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Baumann, H.' 1 ? primary 'Paulsen, K.' 2 ? primary 'Kovacs, H.' 3 ? primary 'Berglund, H.' 4 ? primary 'Wright, A.P.' 5 ? primary 'Gustafsson, J.A.' 6 ? primary 'Hard, T.' 7 ? 1 'Hard, T.' 8 ? 1 'Gustafsson, J.-A.' 9 ? 2 'Berglund, H.' 10 ? 2 'Kovacs, H.' 11 ? 2 'Dahlman-Wright, K.' 12 ? 2 'Gustafsson, J.-A.' 13 ? 2 'Hard, T.' 14 ? 3 'Luisi, B.F.' 15 ? 3 'Xu, W.X.' 16 ? 3 'Otwinowski, Z.' 17 ? 3 'Freedman, L.P.' 18 ? 3 'Yamamoto, K.R.' 19 ? 3 'Sigler, P.B.' 20 ? 4 'Hard, T.' 21 ? 4 'Kellenbach, E.' 22 ? 4 'Boelens, R.' 23 ? 4 'Kaptein, R.' 24 ? 4 'Dahlman, K.' 25 ? 4 'Carlstedt-Duke, J.' 26 ? 4 'Freedman, L.P.' 27 ? 4 'Maler, B.A.' 28 ? 4 'Hyde, E.' 29 ? 4 'Gustafsson, J.-A.' 30 ? 4 'Yamamoto, K.R.' 31 ? 5 'Hard, T.' 32 ? 5 'Kellenbach, E.' 33 ? 5 'Boelens, R.' 34 ? 5 'Maler, B.A.' 35 ? 5 'Dahlman, K.' 36 ? 5 'Freedman, L.P.' 37 ? 5 'Carlstedt-Duke, J.' 38 ? 5 'Yamamoto, K.R.' 39 ? 5 'Gustafsson, J.-A.' 40 ? 5 'Kaptein, R.' 41 ? # _cell.entry_id 1GDC _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1GDC _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GLUCOCORTICOID RECEPTOR' 8075.503 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code LCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEAR _entity_poly.pdbx_seq_one_letter_code_can LCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEAR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 CYS n 1 3 LEU n 1 4 VAL n 1 5 CYS n 1 6 SER n 1 7 ASP n 1 8 GLU n 1 9 ALA n 1 10 SER n 1 11 GLY n 1 12 CYS n 1 13 HIS n 1 14 TYR n 1 15 GLY n 1 16 VAL n 1 17 LEU n 1 18 THR n 1 19 CYS n 1 20 GLY n 1 21 SER n 1 22 CYS n 1 23 LYS n 1 24 VAL n 1 25 PHE n 1 26 PHE n 1 27 LYS n 1 28 ARG n 1 29 ALA n 1 30 VAL n 1 31 GLU n 1 32 GLY n 1 33 GLN n 1 34 HIS n 1 35 ASN n 1 36 TYR n 1 37 LEU n 1 38 CYS n 1 39 ALA n 1 40 GLY n 1 41 ARG n 1 42 ASN n 1 43 ASP n 1 44 CYS n 1 45 ILE n 1 46 ILE n 1 47 ASP n 1 48 LYS n 1 49 ILE n 1 50 ARG n 1 51 ARG n 1 52 LYS n 1 53 ASN n 1 54 CYS n 1 55 PRO n 1 56 ALA n 1 57 CYS n 1 58 ARG n 1 59 TYR n 1 60 ARG n 1 61 LYS n 1 62 CYS n 1 63 LEU n 1 64 GLN n 1 65 ALA n 1 66 GLY n 1 67 MET n 1 68 ASN n 1 69 LEU n 1 70 GLU n 1 71 ALA n 1 72 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GCR_RAT _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P06536 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MDSKESLAPPGRDEVPGSLLGQGRGSVMDFYKSLRGGATVKVSASSPSVAAASQADSKQQRILLDFSKGSTSNVQQRQQQ QQQQQQQQQQQQQQQQPDLSKAVSLSMGLYMGETETKVMGNDLGYPQQGQLGLSSGETDFRLLEESIANLNRSTSVPENP KSSTSATGCATPTEKEFPKTHSDASSEQQNRKSQTGTNGGSVKLYPTDQSTFDLLKDLEFSAGSPSKDTNESPWRSDLLI DENLLSPLAGEDDPFLLEGNTNEDCKPLILPDTKPKIKDTGDTILSSPSSVALPQVKTEKDDFIELCTPGVIKQEKLGPV YCQASFSGTNIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPVFNVIPPIPVGSENWNRCQGSGEDSLTSLGA LNFPGRSVFSNGYSSPGMRPDVSSPPSSSSAATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRN DCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQDTSENPNKTIVPAALPQLTPTLVSLLEVIEPE VLYAGYDSSVPDSAWRIMTTLNMLGGRQVIAAVKWAKAILGLRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSGNLLC FAPDLIINEQRMSLPCMYDQCKHMLFVSSELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIV KREGNSSQNWQRFYQLTKLLDSMHEVVENLLTYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1GDC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P06536 _struct_ref_seq.db_align_beg 439 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 510 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 72 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _pdbx_nmr_ensemble.entry_id 1GDC _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement DGII ? HAVEL 1 refinement CHARMM ? BROOKS 2 # _exptl.entry_id 1GDC _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1GDC _struct.title 'REFINED SOLUTION STRUCTURE OF THE GLUCOCORTICOID RECEPTOR DNA-BINDING DOMAIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1GDC _struct_keywords.pdbx_keywords 'GLUCOCORTICOID RECEPTOR' _struct_keywords.text 'GLUCOCORTICOID RECEPTOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 20 ? GLU A 31 ? GLY A 20 GLU A 31 1 ? 12 HELX_P HELX_P2 2 ILE A 49 ? ASN A 53 ? ILE A 49 ASN A 53 5 ? 5 HELX_P HELX_P3 3 ALA A 56 ? GLY A 66 ? ALA A 56 GLY A 66 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 2 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 2 A ZN 73 1_555 ? ? ? ? ? ? ? 2.323 ? ? metalc2 metalc ? ? A CYS 5 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 5 A ZN 73 1_555 ? ? ? ? ? ? ? 2.318 ? ? metalc3 metalc ? ? A CYS 19 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 19 A ZN 73 1_555 ? ? ? ? ? ? ? 2.332 ? ? metalc4 metalc ? ? A CYS 22 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 22 A ZN 73 1_555 ? ? ? ? ? ? ? 2.314 ? ? metalc5 metalc ? ? A CYS 38 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 38 A ZN 74 1_555 ? ? ? ? ? ? ? 2.320 ? ? metalc6 metalc ? ? A CYS 44 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 44 A ZN 74 1_555 ? ? ? ? ? ? ? 2.340 ? ? metalc7 metalc ? ? A CYS 54 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 54 A ZN 74 1_555 ? ? ? ? ? ? ? 2.315 ? ? metalc8 metalc ? ? A CYS 57 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 57 A ZN 74 1_555 ? ? ? ? ? ? ? 2.316 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 11 ? HIS A 13 ? GLY A 11 HIS A 13 A 2 VAL A 16 ? THR A 18 ? VAL A 16 THR A 18 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id HIS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 13 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id HIS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 13 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 16 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 16 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 73 ? 4 'BINDING SITE FOR RESIDUE ZN A 73' AC2 Software A ZN 74 ? 4 'BINDING SITE FOR RESIDUE ZN A 74' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 2 ? CYS A 2 . ? 1_555 ? 2 AC1 4 CYS A 5 ? CYS A 5 . ? 1_555 ? 3 AC1 4 CYS A 19 ? CYS A 19 . ? 1_555 ? 4 AC1 4 CYS A 22 ? CYS A 22 . ? 1_555 ? 5 AC2 4 CYS A 38 ? CYS A 38 . ? 1_555 ? 6 AC2 4 CYS A 44 ? CYS A 44 . ? 1_555 ? 7 AC2 4 CYS A 54 ? CYS A 54 . ? 1_555 ? 8 AC2 4 CYS A 57 ? CYS A 57 . ? 1_555 ? # _database_PDB_matrix.entry_id 1GDC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1GDC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 MET 67 67 67 MET MET A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ARG 72 72 72 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 73 73 ZN ZN A . C 2 ZN 1 74 74 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 2 ? A CYS 2 ? 1_555 ZN ? B ZN . ? A ZN 73 ? 1_555 SG ? A CYS 5 ? A CYS 5 ? 1_555 112.4 ? 2 SG ? A CYS 2 ? A CYS 2 ? 1_555 ZN ? B ZN . ? A ZN 73 ? 1_555 SG ? A CYS 19 ? A CYS 19 ? 1_555 108.2 ? 3 SG ? A CYS 5 ? A CYS 5 ? 1_555 ZN ? B ZN . ? A ZN 73 ? 1_555 SG ? A CYS 19 ? A CYS 19 ? 1_555 109.0 ? 4 SG ? A CYS 2 ? A CYS 2 ? 1_555 ZN ? B ZN . ? A ZN 73 ? 1_555 SG ? A CYS 22 ? A CYS 22 ? 1_555 108.1 ? 5 SG ? A CYS 5 ? A CYS 5 ? 1_555 ZN ? B ZN . ? A ZN 73 ? 1_555 SG ? A CYS 22 ? A CYS 22 ? 1_555 109.9 ? 6 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 73 ? 1_555 SG ? A CYS 22 ? A CYS 22 ? 1_555 109.1 ? 7 SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? C ZN . ? A ZN 74 ? 1_555 SG ? A CYS 44 ? A CYS 44 ? 1_555 110.2 ? 8 SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? C ZN . ? A ZN 74 ? 1_555 SG ? A CYS 54 ? A CYS 54 ? 1_555 108.4 ? 9 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? C ZN . ? A ZN 74 ? 1_555 SG ? A CYS 54 ? A CYS 54 ? 1_555 107.9 ? 10 SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? C ZN . ? A ZN 74 ? 1_555 SG ? A CYS 57 ? A CYS 57 ? 1_555 108.5 ? 11 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? C ZN . ? A ZN 74 ? 1_555 SG ? A CYS 57 ? A CYS 57 ? 1_555 111.6 ? 12 SG ? A CYS 54 ? A CYS 54 ? 1_555 ZN ? C ZN . ? A ZN 74 ? 1_555 SG ? A CYS 57 ? A CYS 57 ? 1_555 110.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-06-22 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.value' 9 4 'Structure model' '_struct_conn.pdbx_dist_value' 10 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 16 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 22 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 23 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 24 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 4 ? ? -120.21 -70.07 2 1 SER A 6 ? ? 39.08 54.83 3 1 TYR A 14 ? ? 82.17 -115.14 4 1 CYS A 19 ? ? -80.52 -159.02 5 1 VAL A 30 ? ? -104.37 -69.24 6 1 CYS A 38 ? ? -175.22 52.72 7 1 ARG A 41 ? ? -122.10 -91.09 8 1 ASN A 42 ? ? 69.63 61.25 9 1 ILE A 49 ? ? -121.76 -53.52 10 1 GLU A 70 ? ? -158.02 62.43 11 1 ALA A 71 ? ? -104.26 -131.70 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 28 ? ? 0.093 'SIDE CHAIN' 2 1 ARG A 41 ? ? 0.129 'SIDE CHAIN' 3 1 ARG A 50 ? ? 0.077 'SIDE CHAIN' 4 1 ARG A 51 ? ? 0.099 'SIDE CHAIN' 5 1 ARG A 58 ? ? 0.174 'SIDE CHAIN' 6 1 ARG A 60 ? ? 0.111 'SIDE CHAIN' # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #