data_1GM0 # _entry.id 1GM0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1GM0 PDBE EBI-8523 WWPDB D_1290008523 BMRB 6313 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1DQE unspecified 'BOMBYX MORI PHEROMONE BINDING PROTEIN' BMRB 6313 unspecified . # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1GM0 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2001-09-05 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Horst, R.' 1 ? 'Damberger, F.' 2 ? 'Guntert, P.' 3 ? 'Luginbuhl, P.' 4 ? 'Nikonova, L.' 5 ? 'Peng, G.' 6 ? 'Leal, W.S.' 7 ? 'Wuthrich, K.' 8 ? # _citation.id primary _citation.title 'NMR Structure Reveals Novel Intramolecular Regulation Mechanism for Pheromone-Binding and Release' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 98 _citation.page_first 14374 _citation.page_last 14379 _citation.year 2001 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11724947 _citation.pdbx_database_id_DOI 10.1073/PNAS.251532998 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Horst, R.' 1 primary 'Damberger, F.' 2 primary 'Luginbuhl, P.' 3 primary 'Guntert, P.' 4 primary 'Peng, G.' 5 primary 'Nikonova, L.' 6 primary 'Leal, W.S.' 7 primary 'Wuthrich, K.' 8 # _cell.entry_id 1GM0 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1GM0 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PHEROMONE-BINDING PROTEIN' _entity.formula_weight 15903.138 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKH GADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMDVAVGEILAEV ; _entity_poly.pdbx_seq_one_letter_code_can ;SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKH GADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMDVAVGEILAEV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLN n 1 3 GLU n 1 4 VAL n 1 5 MET n 1 6 LYS n 1 7 ASN n 1 8 LEU n 1 9 SER n 1 10 LEU n 1 11 ASN n 1 12 PHE n 1 13 GLY n 1 14 LYS n 1 15 ALA n 1 16 LEU n 1 17 ASP n 1 18 GLU n 1 19 CYS n 1 20 LYS n 1 21 LYS n 1 22 GLU n 1 23 MET n 1 24 THR n 1 25 LEU n 1 26 THR n 1 27 ASP n 1 28 ALA n 1 29 ILE n 1 30 ASN n 1 31 GLU n 1 32 ASP n 1 33 PHE n 1 34 TYR n 1 35 ASN n 1 36 PHE n 1 37 TRP n 1 38 LYS n 1 39 GLU n 1 40 GLY n 1 41 TYR n 1 42 GLU n 1 43 ILE n 1 44 LYS n 1 45 ASN n 1 46 ARG n 1 47 GLU n 1 48 THR n 1 49 GLY n 1 50 CYS n 1 51 ALA n 1 52 ILE n 1 53 MET n 1 54 CYS n 1 55 LEU n 1 56 SER n 1 57 THR n 1 58 LYS n 1 59 LEU n 1 60 ASN n 1 61 MET n 1 62 LEU n 1 63 ASP n 1 64 PRO n 1 65 GLU n 1 66 GLY n 1 67 ASN n 1 68 LEU n 1 69 HIS n 1 70 HIS n 1 71 GLY n 1 72 ASN n 1 73 ALA n 1 74 MET n 1 75 GLU n 1 76 PHE n 1 77 ALA n 1 78 LYS n 1 79 LYS n 1 80 HIS n 1 81 GLY n 1 82 ALA n 1 83 ASP n 1 84 GLU n 1 85 THR n 1 86 MET n 1 87 ALA n 1 88 GLN n 1 89 GLN n 1 90 LEU n 1 91 ILE n 1 92 ASP n 1 93 ILE n 1 94 VAL n 1 95 HIS n 1 96 GLY n 1 97 CYS n 1 98 GLU n 1 99 LYS n 1 100 SER n 1 101 THR n 1 102 PRO n 1 103 ALA n 1 104 ASN n 1 105 ASP n 1 106 ASP n 1 107 LYS n 1 108 CYS n 1 109 ILE n 1 110 TRP n 1 111 THR n 1 112 LEU n 1 113 GLY n 1 114 VAL n 1 115 ALA n 1 116 THR n 1 117 CYS n 1 118 PHE n 1 119 LYS n 1 120 ALA n 1 121 GLU n 1 122 ILE n 1 123 HIS n 1 124 LYS n 1 125 LEU n 1 126 ASN n 1 127 TRP n 1 128 ALA n 1 129 PRO n 1 130 SER n 1 131 MET n 1 132 ASP n 1 133 VAL n 1 134 ALA n 1 135 VAL n 1 136 GLY n 1 137 GLU n 1 138 ILE n 1 139 LEU n 1 140 ALA n 1 141 GLU n 1 142 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'SILKWORM MOTH' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'BOMBYX MORI' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7091 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PBP_BOMMO _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P34174 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1GM0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 142 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P34174 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 164 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 142 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type NOESY _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 750 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_ensemble.entry_id 1GM0 _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1GM0 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement OPAL ? LUGINBUHL,GUNTERT,BILLETER,WUTHRICH 1 'structure solution' C ? ? 2 'structure solution' ID/DYANA ? ? 3 # _exptl.entry_id 1GM0 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1GM0 _struct.title 'A Form of the Pheromone-Binding Protein from Bombyx mori' _struct.pdbx_descriptor 'PHEROMONE-BINDING PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1GM0 _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' _struct_keywords.text 'TRANSPORT PROTEIN, INSECT ODORANT-BINDING PROTEIN, PH-DEPENDENT CONFORMATION, HELICAL INSERTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 11 ? MET A 23 ? ASN A 11 MET A 23 1 ? 13 HELX_P HELX_P2 2 ALA A 28 ? PHE A 36 ? ALA A 28 PHE A 36 1 ? 9 HELX_P HELX_P3 3 ASN A 45 ? SER A 56 ? ASN A 45 SER A 56 1 ? 12 HELX_P HELX_P4 4 LYS A 58 ? ASP A 63 ? LYS A 58 ASP A 63 1 ? 6 HELX_P HELX_P5 5 ALA A 73 ? HIS A 80 ? ALA A 73 HIS A 80 1 ? 8 HELX_P HELX_P6 6 ASP A 83 ? THR A 101 ? ASP A 83 THR A 101 1 ? 19 HELX_P HELX_P7 7 ASP A 106 ? HIS A 123 ? ASP A 106 HIS A 123 1 ? 18 HELX_P HELX_P8 8 SER A 130 ? VAL A 142 ? SER A 130 VAL A 142 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 54 SG ? ? A CYS 19 A CYS 54 1_555 ? ? ? ? ? ? ? 2.032 ? disulf2 disulf ? ? A CYS 50 SG ? ? ? 1_555 A CYS 108 SG ? ? A CYS 50 A CYS 108 1_555 ? ? ? ? ? ? ? 2.034 ? disulf3 disulf ? ? A CYS 97 SG ? ? ? 1_555 A CYS 117 SG ? ? A CYS 97 A CYS 117 1_555 ? ? ? ? ? ? ? 2.036 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1GM0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1GM0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 MET 74 74 74 MET MET A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 CYS 97 97 97 CYS CYS A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 CYS 108 108 108 CYS CYS A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 TRP 110 110 110 TRP TRP A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 CYS 117 117 117 CYS CYS A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 TRP 127 127 127 TRP TRP A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 MET 131 131 131 MET MET A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 VAL 142 142 142 VAL VAL A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-11-30 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' struct # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.page_last' 2 4 'Structure model' '_struct.title' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 15 _pdbx_validate_close_contact.auth_atom_id_1 HG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 56 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 VAL _pdbx_validate_close_contact.auth_seq_id_2 142 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.55 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 7 CA A CYS 108 ? ? CB A CYS 108 ? ? SG A CYS 108 ? ? 122.72 114.20 8.52 1.10 N 2 8 CA A CYS 50 ? ? CB A CYS 50 ? ? SG A CYS 50 ? ? 121.61 114.20 7.41 1.10 N 3 9 CB A TYR 41 ? ? CG A TYR 41 ? ? CD2 A TYR 41 ? ? 117.21 121.00 -3.79 0.60 N 4 11 CA A CYS 50 ? ? CB A CYS 50 ? ? SG A CYS 50 ? ? 122.03 114.20 7.83 1.10 N 5 12 CB A TYR 41 ? ? CG A TYR 41 ? ? CD2 A TYR 41 ? ? 117.14 121.00 -3.86 0.60 N 6 12 CA A CYS 50 ? ? CB A CYS 50 ? ? SG A CYS 50 ? ? 121.00 114.20 6.80 1.10 N 7 13 CA A CYS 50 ? ? CB A CYS 50 ? ? SG A CYS 50 ? ? 120.99 114.20 6.79 1.10 N 8 14 CA A CYS 50 ? ? CB A CYS 50 ? ? SG A CYS 50 ? ? 122.12 114.20 7.92 1.10 N 9 15 CA A CYS 50 ? ? CB A CYS 50 ? ? SG A CYS 50 ? ? 121.84 114.20 7.64 1.10 N 10 15 CB A ASP 63 ? ? CG A ASP 63 ? ? OD2 A ASP 63 ? ? 112.85 118.30 -5.45 0.90 N 11 16 CA A CYS 108 ? ? CB A CYS 108 ? ? SG A CYS 108 ? ? 120.85 114.20 6.65 1.10 N 12 18 CA A CYS 108 ? ? CB A CYS 108 ? ? SG A CYS 108 ? ? 122.23 114.20 8.03 1.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 8 ? ? 53.50 97.34 2 1 ILE A 29 ? ? -39.30 -35.82 3 1 ILE A 43 ? ? -100.36 76.21 4 1 LYS A 44 ? ? -108.97 55.36 5 1 ALA A 103 ? ? -61.01 97.02 6 2 MET A 5 ? ? -145.22 37.14 7 2 LEU A 8 ? ? 50.92 111.10 8 2 LEU A 10 ? ? -65.59 -179.53 9 2 LEU A 25 ? ? -55.11 173.47 10 2 LEU A 68 ? ? -67.06 88.18 11 2 ASN A 72 ? ? -151.51 79.79 12 2 ALA A 103 ? ? -62.50 91.95 13 2 VAL A 133 ? ? -64.29 -71.77 14 3 MET A 5 ? ? -141.93 12.05 15 3 LYS A 6 ? ? -75.61 -164.44 16 3 LEU A 8 ? ? 51.16 98.42 17 3 ASN A 11 ? ? -106.19 60.94 18 3 ASN A 72 ? ? -152.91 82.40 19 3 ALA A 103 ? ? -65.65 93.72 20 3 VAL A 133 ? ? -61.97 -76.09 21 4 GLU A 3 ? ? -96.63 41.03 22 4 LYS A 6 ? ? -64.43 -176.59 23 4 LEU A 25 ? ? -59.96 172.67 24 4 ASN A 72 ? ? -150.71 52.53 25 4 ASP A 83 ? ? -66.00 -179.53 26 4 ALA A 103 ? ? -68.60 90.54 27 4 ALA A 140 ? ? -58.31 -9.96 28 5 VAL A 4 ? ? -104.98 66.44 29 5 LYS A 6 ? ? -66.83 -172.49 30 5 LEU A 8 ? ? -38.68 123.43 31 5 ASN A 45 ? ? -75.79 -169.91 32 5 ASN A 72 ? ? -150.93 36.04 33 5 ALA A 103 ? ? -54.77 93.99 34 6 VAL A 4 ? ? -118.16 52.98 35 6 LYS A 6 ? ? -55.07 173.28 36 6 LEU A 8 ? ? 54.80 98.16 37 6 ASN A 11 ? ? -104.88 59.63 38 6 THR A 24 ? ? 37.56 58.74 39 6 GLU A 42 ? ? -76.04 44.54 40 6 ALA A 103 ? ? -51.83 96.49 41 6 VAL A 133 ? ? -61.90 -72.16 42 6 ILE A 138 ? ? -59.96 -6.18 43 7 GLU A 3 ? ? -146.48 46.87 44 7 LEU A 8 ? ? 56.19 113.97 45 7 ASN A 72 ? ? -159.81 81.96 46 7 ALA A 103 ? ? -66.83 91.34 47 7 VAL A 133 ? ? -58.09 -70.50 48 7 GLU A 141 ? ? -125.28 -64.14 49 8 LEU A 8 ? ? 51.41 105.19 50 8 LEU A 25 ? ? -56.74 173.86 51 8 ASN A 45 ? ? -75.78 -168.01 52 8 LEU A 68 ? ? -64.69 94.12 53 9 VAL A 4 ? ? 39.53 71.06 54 9 LYS A 6 ? ? -75.74 -166.20 55 9 ASN A 7 ? ? -47.87 162.12 56 9 LEU A 8 ? ? 41.95 94.41 57 9 LEU A 10 ? ? -64.88 -171.66 58 9 THR A 24 ? ? 36.97 72.69 59 10 LEU A 8 ? ? 55.38 116.19 60 10 THR A 24 ? ? 37.56 69.34 61 10 ASP A 83 ? ? -69.56 -178.46 62 10 ALA A 103 ? ? -68.26 82.35 63 11 MET A 5 ? ? -142.75 38.69 64 11 LYS A 6 ? ? -64.79 -164.62 65 11 ASN A 7 ? ? -41.19 164.62 66 11 LEU A 8 ? ? 25.00 99.06 67 11 LEU A 25 ? ? -56.50 173.34 68 11 ASN A 72 ? ? -155.26 44.69 69 11 ALA A 103 ? ? -68.34 92.80 70 11 GLU A 141 ? ? -123.54 -57.76 71 12 GLU A 3 ? ? -142.84 47.89 72 12 LEU A 8 ? ? 56.23 104.34 73 12 ASN A 11 ? ? -112.90 65.46 74 12 ASN A 72 ? ? -151.69 78.70 75 12 ASP A 83 ? ? -105.16 -165.25 76 13 GLU A 3 ? ? -104.44 49.24 77 13 LEU A 8 ? ? 58.78 100.92 78 13 LEU A 25 ? ? -53.26 174.43 79 13 ASP A 63 ? ? -46.52 92.70 80 13 ASP A 83 ? ? -65.38 -179.23 81 13 ALA A 140 ? ? -59.73 -7.60 82 14 LEU A 8 ? ? 45.33 92.22 83 14 LEU A 25 ? ? -79.79 -169.84 84 14 ALA A 103 ? ? -65.70 94.16 85 15 MET A 5 ? ? -140.15 31.20 86 15 LYS A 6 ? ? -69.13 -179.02 87 15 ASN A 11 ? ? -74.73 49.72 88 15 THR A 24 ? ? 57.48 71.98 89 15 ASN A 60 ? ? -59.03 -9.26 90 15 ALA A 103 ? ? -59.01 99.79 91 16 GLN A 2 ? ? 49.61 -166.42 92 16 MET A 5 ? ? -141.80 15.21 93 16 ASN A 45 ? ? -70.13 -154.66 94 16 ASN A 72 ? ? -155.52 60.77 95 16 ALA A 103 ? ? -48.57 95.07 96 16 ASP A 105 ? ? -37.73 -35.68 97 17 GLN A 2 ? ? 62.59 171.57 98 17 VAL A 4 ? ? 35.87 57.05 99 17 LYS A 6 ? ? -60.41 -165.26 100 17 ASN A 7 ? ? -49.24 162.55 101 17 LEU A 8 ? ? 54.01 101.01 102 17 LEU A 10 ? ? -57.48 176.78 103 17 ASN A 11 ? ? -114.98 70.79 104 17 THR A 24 ? ? 29.54 69.26 105 17 ILE A 29 ? ? -132.67 -37.31 106 17 LYS A 44 ? ? -118.09 55.02 107 17 ALA A 103 ? ? -67.00 89.93 108 18 LYS A 6 ? ? -65.79 -176.51 109 18 ASN A 7 ? ? -47.81 152.24 110 18 LEU A 8 ? ? 53.98 109.82 111 18 ASN A 11 ? ? -103.45 64.67 112 18 ASN A 45 ? ? -72.08 -154.79 113 18 ASN A 72 ? ? -151.02 78.69 114 18 ALA A 103 ? ? -52.00 98.78 115 18 ALA A 140 ? ? -57.87 -7.14 116 18 GLU A 141 ? ? -124.48 -60.14 117 19 LEU A 25 ? ? -59.54 172.99 118 19 ALA A 28 ? ? -72.17 28.88 119 19 TYR A 41 ? ? -52.16 105.02 120 19 ALA A 103 ? ? -49.42 100.92 121 19 ALA A 140 ? ? -54.64 -9.40 122 20 VAL A 4 ? ? -84.83 34.54 123 20 LEU A 8 ? ? 50.00 100.38 124 20 LEU A 25 ? ? -56.77 173.39 125 20 ASN A 72 ? ? -146.80 40.83 126 20 ALA A 140 ? ? -58.96 -6.53 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 9 MET A 23 ? ? THR A 24 ? ? -148.18 2 17 SER A 1 ? ? GLN A 2 ? ? -136.12 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 TYR A 34 ? ? 0.072 'SIDE CHAIN' 2 2 TYR A 41 ? ? 0.106 'SIDE CHAIN' 3 2 ARG A 46 ? ? 0.100 'SIDE CHAIN' 4 3 TYR A 41 ? ? 0.064 'SIDE CHAIN' 5 7 TYR A 41 ? ? 0.120 'SIDE CHAIN' 6 8 TYR A 34 ? ? 0.085 'SIDE CHAIN' 7 8 TYR A 41 ? ? 0.086 'SIDE CHAIN' 8 11 TYR A 41 ? ? 0.079 'SIDE CHAIN' 9 11 ARG A 46 ? ? 0.096 'SIDE CHAIN' 10 13 TYR A 41 ? ? 0.127 'SIDE CHAIN' 11 15 TYR A 41 ? ? 0.066 'SIDE CHAIN' 12 17 TYR A 41 ? ? 0.092 'SIDE CHAIN' 13 17 ARG A 46 ? ? 0.099 'SIDE CHAIN' 14 18 ARG A 46 ? ? 0.084 'SIDE CHAIN' 15 18 ASP A 132 ? ? 0.097 'SIDE CHAIN' #