data_1GNA # _entry.id 1GNA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1GNA pdb_00001gna 10.2210/pdb1gna/pdb WWPDB D_1000173627 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-09-30 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 5 'Structure model' 1 4 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1GNA _pdbx_database_status.recvd_initial_deposition_date 1994-06-30 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Skelton, N.J.' 1 'Garcia, K.C.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Determination of the solution structure of the peptide hormone guanylin: observation of a novel form of topological stereoisomerism. ; Biochemistry 33 13581 13592 1994 BICHAW US 0006-2960 0033 ? 7947768 10.1021/bi00250a010 1 'Processing and Characterization of Human Proguanylin Expressed in Escherichia Coli' J.Biol.Chem. 268 22397 ? 1993 JBCHA3 US 0021-9258 0071 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Skelton, N.J.' 1 ? primary 'Garcia, K.C.' 2 ? primary 'Goeddel, D.V.' 3 ? primary 'Quan, C.' 4 ? primary 'Burnier, J.P.' 5 ? 1 'Garcia, K.C.' 6 ? 1 'De Sauvage, F.J.' 7 ? 1 'Struble, M.' 8 ? 1 'Henzel, W.' 9 ? 1 'Reilly, D.' 10 ? 1 'Goeddel, D.V.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'GUANYLIN PRECURSOR' _entity.formula_weight 1308.525 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code TCEICAYAACTGC _entity_poly.pdbx_seq_one_letter_code_can TCEICAYAACTGC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 CYS n 1 3 GLU n 1 4 ILE n 1 5 CYS n 1 6 ALA n 1 7 TYR n 1 8 ALA n 1 9 ALA n 1 10 CYS n 1 11 THR n 1 12 GLY n 1 13 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 87 87 THR THR A . n A 1 2 CYS 2 88 88 CYS CYS A . n A 1 3 GLU 3 89 89 GLU GLU A . n A 1 4 ILE 4 90 90 ILE ILE A . n A 1 5 CYS 5 91 91 CYS CYS A . n A 1 6 ALA 6 92 92 ALA ALA A . n A 1 7 TYR 7 93 93 TYR TYR A . n A 1 8 ALA 8 94 94 ALA ALA A . n A 1 9 ALA 9 95 95 ALA ALA A . n A 1 10 CYS 10 96 96 CYS CYS A . n A 1 11 THR 11 97 97 THR THR A . n A 1 12 GLY 12 98 98 GLY GLY A . n A 1 13 CYS 13 99 99 CYS CYS A . n # _software.name AMBER _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # _cell.entry_id 1GNA _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1GNA _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1GNA _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1GNA _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1GNA _struct.title 'DETERMINATION OF THE SOLUTION STRUCTURE OF THE PEPTIDE HORMONE GUANYLIN: OBSERVATION OF A NOVEL FORM OF TOPOLOGICAL STEREOISOMERISM' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1GNA _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text HORMONE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GUC2A_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q02747 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MNAFLLFALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKP LCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1GNA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 13 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q02747 _struct_ref_seq.db_align_beg 103 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 115 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 87 _struct_ref_seq.pdbx_auth_seq_align_end 99 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 10 SG ? ? A CYS 88 A CYS 96 1_555 ? ? ? ? ? ? ? 2.077 ? ? disulf2 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 13 SG ? ? A CYS 91 A CYS 99 1_555 ? ? ? ? ? ? ? 2.077 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 2 ? CYS A 10 ? CYS A 88 ? 1_555 CYS A 96 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 5 ? CYS A 13 ? CYS A 91 ? 1_555 CYS A 99 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 1GNA _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 88 ? ? -80.99 39.79 2 1 THR A 97 ? ? -68.29 -173.77 3 2 THR A 97 ? ? -77.38 -157.54 4 3 THR A 97 ? ? -68.08 -173.59 5 5 CYS A 88 ? ? -72.23 30.80 6 5 THR A 97 ? ? -72.15 -169.08 7 6 THR A 97 ? ? -67.85 -174.31 8 7 CYS A 88 ? ? -76.08 39.05 9 7 THR A 97 ? ? -69.75 -171.82 10 8 CYS A 91 ? ? 38.34 66.28 11 9 CYS A 88 ? ? -78.59 33.51 12 10 CYS A 88 ? ? -80.71 48.47 13 10 THR A 97 ? ? -76.11 -164.76 14 11 CYS A 88 ? ? -77.79 46.91 15 11 THR A 97 ? ? -75.97 -165.11 16 12 THR A 97 ? ? -77.83 -155.93 17 13 THR A 97 ? ? -76.73 -165.86 18 14 THR A 97 ? ? -68.12 -173.98 19 15 CYS A 91 ? ? 36.22 56.75 20 15 THR A 97 ? ? -69.50 -171.17 21 18 CYS A 91 ? ? 36.90 57.50 22 20 CYS A 88 ? ? -77.15 26.18 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 11 TYR A 93 ? ? 0.082 'SIDE CHAIN' 2 13 TYR A 93 ? ? 0.086 'SIDE CHAIN' 3 16 TYR A 93 ? ? 0.123 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1GNA _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 CYS N N N N 14 CYS CA C N R 15 CYS C C N N 16 CYS O O N N 17 CYS CB C N N 18 CYS SG S N N 19 CYS OXT O N N 20 CYS H H N N 21 CYS H2 H N N 22 CYS HA H N N 23 CYS HB2 H N N 24 CYS HB3 H N N 25 CYS HG H N N 26 CYS HXT H N N 27 GLU N N N N 28 GLU CA C N S 29 GLU C C N N 30 GLU O O N N 31 GLU CB C N N 32 GLU CG C N N 33 GLU CD C N N 34 GLU OE1 O N N 35 GLU OE2 O N N 36 GLU OXT O N N 37 GLU H H N N 38 GLU H2 H N N 39 GLU HA H N N 40 GLU HB2 H N N 41 GLU HB3 H N N 42 GLU HG2 H N N 43 GLU HG3 H N N 44 GLU HE2 H N N 45 GLU HXT H N N 46 GLY N N N N 47 GLY CA C N N 48 GLY C C N N 49 GLY O O N N 50 GLY OXT O N N 51 GLY H H N N 52 GLY H2 H N N 53 GLY HA2 H N N 54 GLY HA3 H N N 55 GLY HXT H N N 56 ILE N N N N 57 ILE CA C N S 58 ILE C C N N 59 ILE O O N N 60 ILE CB C N S 61 ILE CG1 C N N 62 ILE CG2 C N N 63 ILE CD1 C N N 64 ILE OXT O N N 65 ILE H H N N 66 ILE H2 H N N 67 ILE HA H N N 68 ILE HB H N N 69 ILE HG12 H N N 70 ILE HG13 H N N 71 ILE HG21 H N N 72 ILE HG22 H N N 73 ILE HG23 H N N 74 ILE HD11 H N N 75 ILE HD12 H N N 76 ILE HD13 H N N 77 ILE HXT H N N 78 THR N N N N 79 THR CA C N S 80 THR C C N N 81 THR O O N N 82 THR CB C N R 83 THR OG1 O N N 84 THR CG2 C N N 85 THR OXT O N N 86 THR H H N N 87 THR H2 H N N 88 THR HA H N N 89 THR HB H N N 90 THR HG1 H N N 91 THR HG21 H N N 92 THR HG22 H N N 93 THR HG23 H N N 94 THR HXT H N N 95 TYR N N N N 96 TYR CA C N S 97 TYR C C N N 98 TYR O O N N 99 TYR CB C N N 100 TYR CG C Y N 101 TYR CD1 C Y N 102 TYR CD2 C Y N 103 TYR CE1 C Y N 104 TYR CE2 C Y N 105 TYR CZ C Y N 106 TYR OH O N N 107 TYR OXT O N N 108 TYR H H N N 109 TYR H2 H N N 110 TYR HA H N N 111 TYR HB2 H N N 112 TYR HB3 H N N 113 TYR HD1 H N N 114 TYR HD2 H N N 115 TYR HE1 H N N 116 TYR HE2 H N N 117 TYR HH H N N 118 TYR HXT H N N 119 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 CYS N CA sing N N 13 CYS N H sing N N 14 CYS N H2 sing N N 15 CYS CA C sing N N 16 CYS CA CB sing N N 17 CYS CA HA sing N N 18 CYS C O doub N N 19 CYS C OXT sing N N 20 CYS CB SG sing N N 21 CYS CB HB2 sing N N 22 CYS CB HB3 sing N N 23 CYS SG HG sing N N 24 CYS OXT HXT sing N N 25 GLU N CA sing N N 26 GLU N H sing N N 27 GLU N H2 sing N N 28 GLU CA C sing N N 29 GLU CA CB sing N N 30 GLU CA HA sing N N 31 GLU C O doub N N 32 GLU C OXT sing N N 33 GLU CB CG sing N N 34 GLU CB HB2 sing N N 35 GLU CB HB3 sing N N 36 GLU CG CD sing N N 37 GLU CG HG2 sing N N 38 GLU CG HG3 sing N N 39 GLU CD OE1 doub N N 40 GLU CD OE2 sing N N 41 GLU OE2 HE2 sing N N 42 GLU OXT HXT sing N N 43 GLY N CA sing N N 44 GLY N H sing N N 45 GLY N H2 sing N N 46 GLY CA C sing N N 47 GLY CA HA2 sing N N 48 GLY CA HA3 sing N N 49 GLY C O doub N N 50 GLY C OXT sing N N 51 GLY OXT HXT sing N N 52 ILE N CA sing N N 53 ILE N H sing N N 54 ILE N H2 sing N N 55 ILE CA C sing N N 56 ILE CA CB sing N N 57 ILE CA HA sing N N 58 ILE C O doub N N 59 ILE C OXT sing N N 60 ILE CB CG1 sing N N 61 ILE CB CG2 sing N N 62 ILE CB HB sing N N 63 ILE CG1 CD1 sing N N 64 ILE CG1 HG12 sing N N 65 ILE CG1 HG13 sing N N 66 ILE CG2 HG21 sing N N 67 ILE CG2 HG22 sing N N 68 ILE CG2 HG23 sing N N 69 ILE CD1 HD11 sing N N 70 ILE CD1 HD12 sing N N 71 ILE CD1 HD13 sing N N 72 ILE OXT HXT sing N N 73 THR N CA sing N N 74 THR N H sing N N 75 THR N H2 sing N N 76 THR CA C sing N N 77 THR CA CB sing N N 78 THR CA HA sing N N 79 THR C O doub N N 80 THR C OXT sing N N 81 THR CB OG1 sing N N 82 THR CB CG2 sing N N 83 THR CB HB sing N N 84 THR OG1 HG1 sing N N 85 THR CG2 HG21 sing N N 86 THR CG2 HG22 sing N N 87 THR CG2 HG23 sing N N 88 THR OXT HXT sing N N 89 TYR N CA sing N N 90 TYR N H sing N N 91 TYR N H2 sing N N 92 TYR CA C sing N N 93 TYR CA CB sing N N 94 TYR CA HA sing N N 95 TYR C O doub N N 96 TYR C OXT sing N N 97 TYR CB CG sing N N 98 TYR CB HB2 sing N N 99 TYR CB HB3 sing N N 100 TYR CG CD1 doub Y N 101 TYR CG CD2 sing Y N 102 TYR CD1 CE1 sing Y N 103 TYR CD1 HD1 sing N N 104 TYR CD2 CE2 doub Y N 105 TYR CD2 HD2 sing N N 106 TYR CE1 CZ doub Y N 107 TYR CE1 HE1 sing N N 108 TYR CE2 CZ sing Y N 109 TYR CE2 HE2 sing N N 110 TYR CZ OH sing N N 111 TYR OH HH sing N N 112 TYR OXT HXT sing N N 113 # _atom_sites.entry_id 1GNA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_