data_1GOE # _entry.id 1GOE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1GOE PDBE EBI-8730 WWPDB D_1290008730 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1GOE _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2001-10-20 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Spyroulias, G.A.' 1 'Papazacharias, S.' 2 'Pairas, G.' 3 'Cordopatis, P.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Monitoring the Structural Consequences of Phe12-->D-Phe and Leu15-->Aib Substitution in Human/Rat Corticotropin Releasing Hormone' Eur.J.Biochem. 269 6009 ? 2002 EJBCAI IX 0014-2956 0262 ? 12473096 10.1046/J.1432-1033.2002.03278.X 1 'Solution Structure of Human Corticotropin Releasing Factor by 1H NMR and Distance Geometry with Restrained Molecular Dynamics.' 'Protein Eng.' 6 149 ? 1993 PRENE9 UK 0269-2139 0859 ? 8386360 10.1093/PROTEIN/6.2.149 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Spyroulias, G.A.' 1 primary 'Papazacharias, S.' 2 primary 'Pairas, G.' 3 primary 'Cordopatis, P.' 4 1 'Romier, C.' 5 1 'Bernassau, J.M.' 6 1 'Cambillau, C.' 7 1 'Darbon, H.' 8 # _cell.entry_id 1GOE _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1GOE _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'CORTICOTROPIN RELEASING HORMONE' _entity.formula_weight 4734.436 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation YES _entity.pdbx_fragment ? _entity.details 'SYNTHETIC ANALOGUE WITH ISOLEUCINE-AMIDE C-TERMINUS' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'SEEPPISLDLT(DPN)HL(AIB)REVLEMARAEQLAQQAHSNRKLMEII(NH2)' _entity_poly.pdbx_seq_one_letter_code_can SEEPPISLDLTFHLAREVLEMARAEQLAQQAHSNRKLMEIIX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLU n 1 3 GLU n 1 4 PRO n 1 5 PRO n 1 6 ILE n 1 7 SER n 1 8 LEU n 1 9 ASP n 1 10 LEU n 1 11 THR n 1 12 DPN n 1 13 HIS n 1 14 LEU n 1 15 AIB n 1 16 ARG n 1 17 GLU n 1 18 VAL n 1 19 LEU n 1 20 GLU n 1 21 MET n 1 22 ALA n 1 23 ARG n 1 24 ALA n 1 25 GLU n 1 26 GLN n 1 27 LEU n 1 28 ALA n 1 29 GLN n 1 30 GLN n 1 31 ALA n 1 32 HIS n 1 33 SER n 1 34 ASN n 1 35 ARG n 1 36 LYS n 1 37 LEU n 1 38 MET n 1 39 GLU n 1 40 ILE n 1 41 ILE n 1 42 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'HOMO SAPIENS' _pdbx_entity_src_syn.organism_common_name HUMAN _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ;SYNTHETIC ANALOGUE SYNTHESIZED THROUGH SOLID PHASE SYNTHESIS USING FMOC/TBU SYNTHETIC PROTOCOLS. NATIVE PHE12 AND LEU15 HAS BEEN SUBSTITUTED BY D-PHE AND ALPHA-AMINOISOBUTYRIC ACID ; # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CRF_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P06850 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1GOE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 41 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P06850 _struct_ref_seq.db_align_beg 154 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 194 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 41 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1GOE DPN A 12 ? UNP P06850 PHE 165 'engineered mutation' 12 1 1 1GOE AIB A 15 ? UNP P06850 LEU 168 'engineered mutation' 15 2 1 1GOE NH2 A 42 ? UNP P06850 ? ? amidation 42 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight AIB 'L-peptide linking' n 'ALPHA-AMINOISOBUTYRIC ACID' ? 'C4 H9 N O2' 103.120 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 DPN 'D-peptide linking' . D-PHENYLALANINE ? 'C9 H11 N O2' 165.189 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 COSY 1 2 1 TOCSY 1 3 1 NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 3.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '34% H2O / 66% TFE' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AMX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1GOE _pdbx_nmr_refine.method 'HYBRID DISTANCE GEOMETRY SIMULATED ANNEALING IN TORSION ANGLE SPACE' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1GOE _pdbx_nmr_details.text ;THE STRUCTURE WAS DETERMINED USING 1H-1H DOUBLE-RESONANCE NMR SPECTROSCOPY. NMR-DERRIVED DISTANCE RESTRAINTS AND 3JHAHN COUPLING CONSTANTS AS WELL AS H-BOND CONSTRAINTS USED IN STRUCTURAL CALCULATION AND REFIMENT PROCEEDURE. ; # _pdbx_nmr_ensemble.entry_id 1GOE _pdbx_nmr_ensemble.conformers_calculated_total_number 400 _pdbx_nmr_ensemble.conformers_submitted_total_number 40 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATION' # _pdbx_nmr_representative.entry_id 1GOE _pdbx_nmr_representative.conformer_id 20 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement AMBER 5.0 'PETER KOLLMAN, DAVE CASE, KEN MERZ, THOMAS CHEATHAM, CARLOS SIMMERLING, TOM DARDEN' 1 'structure solution' DYANA ? ? 2 'structure solution' AMBER ? ? 3 # _exptl.entry_id 1GOE _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1GOE _struct.title ;Monitoring the structural Consequences of Phe12-->D-Phe12 and Leu15-->Aib15 substitution in h/r Corticotropin Releasing Hormone: Implications for Design of CRH antagonists. ; _struct.pdbx_descriptor 'CORTICOTROPIN RELEASING HORMONE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1GOE _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text 'HORMONE, CORTICOTROPIN RELEASING HORMONE, SYNTHETIC ANALOGUES, SOLID PHASE SYNTHESIS, SOLUTIONS STRUCTURE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 6 ? VAL A 18 ? ILE A 6 VAL A 18 1 ? 13 HELX_P HELX_P2 2 GLU A 20 ? ILE A 40 ? GLU A 20 ILE A 40 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A THR 11 C ? ? ? 1_555 A DPN 12 N ? ? A THR 11 A DPN 12 1_555 ? ? ? ? ? ? ? 1.338 ? covale2 covale ? ? A DPN 12 C ? ? ? 1_555 A HIS 13 N ? ? A DPN 12 A HIS 13 1_555 ? ? ? ? ? ? ? 1.332 ? covale3 covale ? ? A LEU 14 C ? ? ? 1_555 A AIB 15 N ? ? A LEU 14 A AIB 15 1_555 ? ? ? ? ? ? ? 1.338 ? covale4 covale ? ? A AIB 15 C ? ? ? 1_555 A ARG 16 N ? ? A AIB 15 A ARG 16 1_555 ? ? ? ? ? ? ? 1.340 ? covale5 covale ? ? A ILE 41 C ? ? ? 1_555 A NH2 42 N ? ? A ILE 41 A NH2 42 1_555 ? ? ? ? ? ? ? 1.332 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1GOE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1GOE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 DPN 12 12 12 DPN DPN A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 AIB 15 15 15 AIB AIB A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 NH2 42 42 42 NH2 NH2 A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id AIB _pdbx_struct_mod_residue.label_seq_id 15 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id AIB _pdbx_struct_mod_residue.auth_seq_id 15 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id ALA _pdbx_struct_mod_residue.details 'ALPHA-AMINOISOBUTYRIC ACID' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-10-31 2 'Structure model' 1 1 2015-10-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' Other 4 2 'Structure model' 'Source and taxonomy' 5 2 'Structure model' 'Version format compliance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 2 ? ? -153.03 -56.61 2 1 GLU A 17 ? ? -121.41 -61.26 3 2 GLU A 2 ? ? -143.62 -63.41 4 2 GLU A 17 ? ? -122.80 -61.25 5 3 GLU A 2 ? ? -155.01 -71.68 6 3 GLU A 17 ? ? -122.37 -61.54 7 4 ARG A 16 ? ? -69.85 4.76 8 5 GLU A 17 ? ? -92.78 -63.95 9 6 GLU A 17 ? ? -126.30 -63.71 10 7 GLU A 17 ? ? -99.52 -65.75 11 10 GLU A 2 ? ? -152.96 -50.67 12 13 GLU A 2 ? ? -83.40 -85.65 13 13 GLU A 17 ? ? -109.68 -61.78 14 16 GLU A 17 ? ? -120.05 -62.54 15 17 GLU A 17 ? ? -123.58 -60.22 16 18 GLU A 2 ? ? -137.30 -53.60 17 20 GLU A 17 ? ? -121.28 -62.47 18 21 GLU A 17 ? ? -102.51 -64.06 19 22 GLU A 17 ? ? -121.72 -64.47 20 28 LEU A 19 ? ? -132.20 -46.27 21 30 DPN A 12 ? ? -38.49 -47.12 22 31 GLU A 2 ? ? -125.90 -59.98 23 32 GLU A 2 ? ? -141.41 15.36 24 32 ARG A 16 ? ? -68.23 1.68 25 34 GLU A 17 ? ? -121.07 -65.30 26 36 GLU A 3 ? ? -100.07 -61.16 27 37 THR A 11 ? ? -152.20 -56.06 28 38 GLU A 17 ? ? -121.83 -62.22 29 39 ARG A 16 ? ? -77.78 21.14 30 39 GLU A 17 ? ? -124.64 -62.72 31 40 GLU A 17 ? ? -125.33 -63.85 #