data_1GUK # _entry.id 1GUK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1GUK pdb_00001guk 10.2210/pdb1guk/pdb WWPDB D_1000173716 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1GUK _pdbx_database_status.recvd_initial_deposition_date 1997-12-11 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Krengel, U.' 1 'Schroter, K.H.' 2 'Hoier, H.' 3 'Dijkstra, B.W.' 4 # _citation.id primary _citation.title 'Crystal structure of a murine alpha-class glutathione S-transferase involved in cellular defense against oxidative stress.' _citation.journal_abbrev 'FEBS Lett.' _citation.journal_volume 422 _citation.page_first 285 _citation.page_last 290 _citation.year 1998 _citation.journal_id_ASTM FEBLAL _citation.country NE _citation.journal_id_ISSN 0014-5793 _citation.journal_id_CSD 0165 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9498801 _citation.pdbx_database_id_DOI '10.1016/S0014-5793(98)00026-X' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Krengel, U.' 1 ? primary 'Schroter, K.H.' 2 ? primary 'Hoier, H.' 3 ? primary 'Arkema, A.' 4 ? primary 'Kalk, K.H.' 5 ? primary 'Zimniak, P.' 6 ? primary 'Dijkstra, B.W.' 7 ? # _cell.entry_id 1GUK _cell.length_a 114.300 _cell.length_b 95.900 _cell.length_c 50.800 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1GUK _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'GLUTATHIONE S-TRANSFERASE A4-4' _entity.formula_weight 25607.922 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec 2.5.1.18 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MGSTA4-4, GST5.7' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAAKPKLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQKDGHLLFGQVPLVEIDGMMLTQTRAILSYLAAKYN LYGKDLKERVRIDMYADGTQDLMMMIAVAPFKTPKEKEESYDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQL LEAILMVEELSAPVLSDFPLLQAFKTRISNIPTIKKFLQPGSQRKPPPDGPYVEVVRIVLKF ; _entity_poly.pdbx_seq_one_letter_code_can ;MAAKPKLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQKDGHLLFGQVPLVEIDGMMLTQTRAILSYLAAKYN LYGKDLKERVRIDMYADGTQDLMMMIAVAPFKTPKEKEESYDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQL LEAILMVEELSAPVLSDFPLLQAFKTRISNIPTIKKFLQPGSQRKPPPDGPYVEVVRIVLKF ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ALA n 1 4 LYS n 1 5 PRO n 1 6 LYS n 1 7 LEU n 1 8 TYR n 1 9 TYR n 1 10 PHE n 1 11 ASN n 1 12 GLY n 1 13 ARG n 1 14 GLY n 1 15 ARG n 1 16 MET n 1 17 GLU n 1 18 SER n 1 19 ILE n 1 20 ARG n 1 21 TRP n 1 22 LEU n 1 23 LEU n 1 24 ALA n 1 25 ALA n 1 26 ALA n 1 27 GLY n 1 28 VAL n 1 29 GLU n 1 30 PHE n 1 31 GLU n 1 32 GLU n 1 33 GLU n 1 34 PHE n 1 35 LEU n 1 36 GLU n 1 37 THR n 1 38 ARG n 1 39 GLU n 1 40 GLN n 1 41 TYR n 1 42 GLU n 1 43 LYS n 1 44 MET n 1 45 GLN n 1 46 LYS n 1 47 ASP n 1 48 GLY n 1 49 HIS n 1 50 LEU n 1 51 LEU n 1 52 PHE n 1 53 GLY n 1 54 GLN n 1 55 VAL n 1 56 PRO n 1 57 LEU n 1 58 VAL n 1 59 GLU n 1 60 ILE n 1 61 ASP n 1 62 GLY n 1 63 MET n 1 64 MET n 1 65 LEU n 1 66 THR n 1 67 GLN n 1 68 THR n 1 69 ARG n 1 70 ALA n 1 71 ILE n 1 72 LEU n 1 73 SER n 1 74 TYR n 1 75 LEU n 1 76 ALA n 1 77 ALA n 1 78 LYS n 1 79 TYR n 1 80 ASN n 1 81 LEU n 1 82 TYR n 1 83 GLY n 1 84 LYS n 1 85 ASP n 1 86 LEU n 1 87 LYS n 1 88 GLU n 1 89 ARG n 1 90 VAL n 1 91 ARG n 1 92 ILE n 1 93 ASP n 1 94 MET n 1 95 TYR n 1 96 ALA n 1 97 ASP n 1 98 GLY n 1 99 THR n 1 100 GLN n 1 101 ASP n 1 102 LEU n 1 103 MET n 1 104 MET n 1 105 MET n 1 106 ILE n 1 107 ALA n 1 108 VAL n 1 109 ALA n 1 110 PRO n 1 111 PHE n 1 112 LYS n 1 113 THR n 1 114 PRO n 1 115 LYS n 1 116 GLU n 1 117 LYS n 1 118 GLU n 1 119 GLU n 1 120 SER n 1 121 TYR n 1 122 ASP n 1 123 LEU n 1 124 ILE n 1 125 LEU n 1 126 SER n 1 127 ARG n 1 128 ALA n 1 129 LYS n 1 130 THR n 1 131 ARG n 1 132 TYR n 1 133 PHE n 1 134 PRO n 1 135 VAL n 1 136 PHE n 1 137 GLU n 1 138 LYS n 1 139 ILE n 1 140 LEU n 1 141 LYS n 1 142 ASP n 1 143 HIS n 1 144 GLY n 1 145 GLU n 1 146 ALA n 1 147 PHE n 1 148 LEU n 1 149 VAL n 1 150 GLY n 1 151 ASN n 1 152 GLN n 1 153 LEU n 1 154 SER n 1 155 TRP n 1 156 ALA n 1 157 ASP n 1 158 ILE n 1 159 GLN n 1 160 LEU n 1 161 LEU n 1 162 GLU n 1 163 ALA n 1 164 ILE n 1 165 LEU n 1 166 MET n 1 167 VAL n 1 168 GLU n 1 169 GLU n 1 170 LEU n 1 171 SER n 1 172 ALA n 1 173 PRO n 1 174 VAL n 1 175 LEU n 1 176 SER n 1 177 ASP n 1 178 PHE n 1 179 PRO n 1 180 LEU n 1 181 LEU n 1 182 GLN n 1 183 ALA n 1 184 PHE n 1 185 LYS n 1 186 THR n 1 187 ARG n 1 188 ILE n 1 189 SER n 1 190 ASN n 1 191 ILE n 1 192 PRO n 1 193 THR n 1 194 ILE n 1 195 LYS n 1 196 LYS n 1 197 PHE n 1 198 LEU n 1 199 GLN n 1 200 PRO n 1 201 GLY n 1 202 SER n 1 203 GLN n 1 204 ARG n 1 205 LYS n 1 206 PRO n 1 207 PRO n 1 208 PRO n 1 209 ASP n 1 210 GLY n 1 211 PRO n 1 212 TYR n 1 213 VAL n 1 214 GLU n 1 215 VAL n 1 216 VAL n 1 217 ARG n 1 218 ILE n 1 219 VAL n 1 220 LEU n 1 221 LYS n 1 222 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ LUNG _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GSTA4_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P24472 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MAAKPKLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQKDGHLLFGQVPLVEIDGMMLTQTRAILSYLAAKYN LYGKDLKERVRIDMYADGTQDLMMMIAVAPFKTPKEKEESYDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQL LEAILMVEELSAPVLSDFPLLQAFKTRISNIPTIKKFLQPGSQRKPPPDGPYVEVVRIVLKF ; _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1GUK A 1 ? 222 ? P24472 1 ? 222 ? 1 222 2 1 1GUK B 1 ? 222 ? P24472 1 ? 222 ? 1 222 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1GUK _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.7 _exptl_crystal.density_percent_sol 54.8 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.1 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;CRYSTALLIZATION BY HANGING DROP VAPOR DIFFUSION RESERVOIR: 9% PEG 8000, 0.1 M TRIS/HCL PH 8.1, 5% MPD PROTEIN: 10 MG/ML DISSOLVED IN H20 DROP: 5 + 5 MICROLITER, vapor diffusion - hanging drop ; # _diffrn.id 1 _diffrn.ambient_temp 295 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'MAR scanner 180 mm plate' _diffrn_detector.pdbx_collection_date 1994-03-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.04 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SRS BEAMLINE PX9.5' _diffrn_source.pdbx_synchrotron_site SRS _diffrn_source.pdbx_synchrotron_beamline PX9.5 _diffrn_source.pdbx_wavelength 1.04 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1GUK _reflns.observed_criterion_sigma_I 0. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 42. _reflns.d_resolution_high 2.9 _reflns.number_obs 10477 _reflns.number_all ? _reflns.percent_possible_obs 80. _reflns.pdbx_Rmerge_I_obs 0.0760000 _reflns.pdbx_Rsym_value 0.0760000 _reflns.pdbx_netI_over_sigmaI 8.8 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 2.7 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.9 _reflns_shell.d_res_low 3.0 _reflns_shell.percent_possible_all 75.8 _reflns_shell.Rmerge_I_obs 0.3190000 _reflns_shell.pdbx_Rsym_value 0.3190000 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1GUK _refine.ls_number_reflns_obs 9798 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF 5. _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10. _refine.ls_d_res_high 2.9 _refine.ls_percent_reflns_obs 77.8 _refine.ls_R_factor_obs 0.2340000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2340000 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10. _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 40.6 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method 'FREE R' _refine.details ;DURING THE REFINEMENT, 10% OF THE REFLECTIONS WERE SET ASIDE TO CALCULATE THE FREE R-FACTOR. THE LAST CYCLE, WHICH RESULTED IN AN R-FACTOR OF 22.9% AND A FREE R-FACTOR OF 30.3%, WAS THEN REPEATED USING ALL THE REFLECTIONS FOR THE FINAL RESULTS. ; _refine.pdbx_starting_model 'HGSTA1-1 DIMER (1GUH)' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1GUK _refine_analyze.Luzzati_coordinate_error_obs 0.34 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 3432 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 3432 _refine_hist.d_res_high 2.9 _refine_hist.d_res_low 10. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.014 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.71 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 24.23 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 2.91 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 2.90 _refine_ls_shell.d_res_low 3.03 _refine_ls_shell.number_reflns_R_work 1089 _refine_ls_shell.R_factor_R_work 0.3140000 _refine_ls_shell.percent_reflns_obs 69.7 _refine_ls_shell.R_factor_R_free ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARHCSDX.PRO ? 'X-RAY DIFFRACTION' 2 TOPHCSDX.PRO ? 'X-RAY DIFFRACTION' # _struct.entry_id 1GUK _struct.title 'CRYSTAL STRUCTURE OF MURINE ALPHA-CLASS GSTA4-4' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1GUK _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'GLUTATHIONE S-TRANSFERASE, GST, OXIDATIVE STRESS, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 17 ? ALA A 26 ? GLU A 17 ALA A 26 1 ? 10 HELX_P HELX_P2 2 GLU A 39 ? LYS A 46 ? GLU A 39 LYS A 46 1 ? 8 HELX_P HELX_P3 3 THR A 68 ? LYS A 78 ? THR A 68 LYS A 78 1 ? 11 HELX_P HELX_P4 4 LEU A 86 ? PHE A 111 ? LEU A 86 PHE A 111 1 ? 26 HELX_P HELX_P5 5 PRO A 114 ? THR A 130 ? PRO A 114 THR A 130 1 ? 17 HELX_P HELX_P6 6 PHE A 133 ? HIS A 143 ? PHE A 133 HIS A 143 1 ? 11 HELX_P HELX_P7 7 ASP A 157 ? GLU A 168 ? ASP A 157 GLU A 168 1 ? 12 HELX_P HELX_P8 8 PRO A 179 ? SER A 189 ? PRO A 179 SER A 189 1 ? 11 HELX_P HELX_P9 9 PRO A 192 ? PHE A 197 ? PRO A 192 PHE A 197 1 ? 6 HELX_P HELX_P10 10 GLY A 210 ? ILE A 218 ? GLY A 210 ILE A 218 1 ? 9 HELX_P HELX_P11 11 GLU B 17 ? ALA B 26 ? GLU B 17 ALA B 26 1 ? 10 HELX_P HELX_P12 12 GLU B 39 ? LYS B 46 ? GLU B 39 LYS B 46 1 ? 8 HELX_P HELX_P13 13 THR B 68 ? LYS B 78 ? THR B 68 LYS B 78 1 ? 11 HELX_P HELX_P14 14 LEU B 86 ? PHE B 111 ? LEU B 86 PHE B 111 1 ? 26 HELX_P HELX_P15 15 TYR B 121 ? THR B 130 ? TYR B 121 THR B 130 1 ? 10 HELX_P HELX_P16 16 PHE B 133 ? HIS B 143 ? PHE B 133 HIS B 143 1 ? 11 HELX_P HELX_P17 17 ASP B 157 ? GLU B 168 ? ASP B 157 GLU B 168 1 ? 12 HELX_P HELX_P18 18 PRO B 179 ? SER B 189 ? PRO B 179 SER B 189 1 ? 11 HELX_P HELX_P19 19 PRO B 192 ? LEU B 198 ? PRO B 192 LEU B 198 1 ? 7 HELX_P HELX_P20 20 VAL B 213 ? ILE B 218 ? VAL B 213 ILE B 218 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 VAL 55 A . ? VAL 55 A PRO 56 A ? PRO 56 A 1 11.96 2 VAL 55 B . ? VAL 55 B PRO 56 B ? PRO 56 B 1 11.22 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 31 ? PHE A 34 ? GLU A 31 PHE A 34 A 2 LYS A 6 ? TYR A 9 ? LYS A 6 TYR A 9 A 3 LEU A 57 ? ILE A 60 ? LEU A 57 ILE A 60 A 4 MET A 63 ? LEU A 65 ? MET A 63 LEU A 65 B 1 GLU B 31 ? PHE B 34 ? GLU B 31 PHE B 34 B 2 LYS B 6 ? TYR B 9 ? LYS B 6 TYR B 9 B 3 LEU B 57 ? ILE B 60 ? LEU B 57 ILE B 60 B 4 MET B 63 ? LEU B 65 ? MET B 63 LEU B 65 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 31 ? O GLU A 31 N LEU A 7 ? N LEU A 7 A 2 3 O LYS A 6 ? O LYS A 6 N GLU A 59 ? N GLU A 59 A 3 4 O VAL A 58 ? O VAL A 58 N LEU A 65 ? N LEU A 65 B 1 2 O GLU B 31 ? O GLU B 31 N LEU B 7 ? N LEU B 7 B 2 3 O LYS B 6 ? O LYS B 6 N GLU B 59 ? N GLU B 59 B 3 4 O VAL B 58 ? O VAL B 58 N LEU B 65 ? N LEU B 65 # _database_PDB_matrix.entry_id 1GUK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1GUK _atom_sites.fract_transf_matrix[1][1] 0.008749 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010428 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019685 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 LYS 4 4 ? ? ? A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 MET 63 63 63 MET MET A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 MET 94 94 94 MET MET A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 MET 103 103 103 MET MET A . n A 1 104 MET 104 104 104 MET MET A . n A 1 105 MET 105 105 105 MET MET A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 ASN 151 151 151 ASN ASN A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 TRP 155 155 155 TRP TRP A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 MET 166 166 166 MET MET A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 PRO 173 173 173 PRO PRO A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 PHE 178 178 178 PHE PHE A . n A 1 179 PRO 179 179 179 PRO PRO A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 GLN 182 182 182 GLN GLN A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 PHE 184 184 184 PHE PHE A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 THR 186 186 186 THR THR A . n A 1 187 ARG 187 187 187 ARG ARG A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 SER 189 189 189 SER SER A . n A 1 190 ASN 190 190 190 ASN ASN A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 PRO 192 192 192 PRO PRO A . n A 1 193 THR 193 193 193 THR THR A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 LYS 195 195 195 LYS LYS A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 PHE 197 197 197 PHE PHE A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 GLN 199 199 199 GLN GLN A . n A 1 200 PRO 200 200 200 PRO PRO A . n A 1 201 GLY 201 201 201 GLY GLY A . n A 1 202 SER 202 202 202 SER SER A . n A 1 203 GLN 203 203 203 GLN GLN A . n A 1 204 ARG 204 204 204 ARG ARG A . n A 1 205 LYS 205 205 205 LYS LYS A . n A 1 206 PRO 206 206 206 PRO PRO A . n A 1 207 PRO 207 207 207 PRO PRO A . n A 1 208 PRO 208 208 208 PRO PRO A . n A 1 209 ASP 209 209 209 ASP ASP A . n A 1 210 GLY 210 210 210 GLY GLY A . n A 1 211 PRO 211 211 211 PRO PRO A . n A 1 212 TYR 212 212 212 TYR TYR A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 GLU 214 214 214 GLU GLU A . n A 1 215 VAL 215 215 215 VAL VAL A . n A 1 216 VAL 216 216 216 VAL VAL A . n A 1 217 ARG 217 217 217 ARG ARG A . n A 1 218 ILE 218 218 218 ILE ILE A . n A 1 219 VAL 219 219 219 VAL VAL A . n A 1 220 LEU 220 220 ? ? ? A . n A 1 221 LYS 221 221 ? ? ? A . n A 1 222 PHE 222 222 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 ALA 2 2 ? ? ? B . n B 1 3 ALA 3 3 ? ? ? B . n B 1 4 LYS 4 4 ? ? ? B . n B 1 5 PRO 5 5 5 PRO PRO B . n B 1 6 LYS 6 6 6 LYS LYS B . n B 1 7 LEU 7 7 7 LEU LEU B . n B 1 8 TYR 8 8 8 TYR TYR B . n B 1 9 TYR 9 9 9 TYR TYR B . n B 1 10 PHE 10 10 10 PHE PHE B . n B 1 11 ASN 11 11 11 ASN ASN B . n B 1 12 GLY 12 12 12 GLY GLY B . n B 1 13 ARG 13 13 13 ARG ARG B . n B 1 14 GLY 14 14 14 GLY GLY B . n B 1 15 ARG 15 15 15 ARG ARG B . n B 1 16 MET 16 16 16 MET MET B . n B 1 17 GLU 17 17 17 GLU GLU B . n B 1 18 SER 18 18 18 SER SER B . n B 1 19 ILE 19 19 19 ILE ILE B . n B 1 20 ARG 20 20 20 ARG ARG B . n B 1 21 TRP 21 21 21 TRP TRP B . n B 1 22 LEU 22 22 22 LEU LEU B . n B 1 23 LEU 23 23 23 LEU LEU B . n B 1 24 ALA 24 24 24 ALA ALA B . n B 1 25 ALA 25 25 25 ALA ALA B . n B 1 26 ALA 26 26 26 ALA ALA B . n B 1 27 GLY 27 27 27 GLY GLY B . n B 1 28 VAL 28 28 28 VAL VAL B . n B 1 29 GLU 29 29 29 GLU GLU B . n B 1 30 PHE 30 30 30 PHE PHE B . n B 1 31 GLU 31 31 31 GLU GLU B . n B 1 32 GLU 32 32 32 GLU GLU B . n B 1 33 GLU 33 33 33 GLU GLU B . n B 1 34 PHE 34 34 34 PHE PHE B . n B 1 35 LEU 35 35 35 LEU LEU B . n B 1 36 GLU 36 36 36 GLU GLU B . n B 1 37 THR 37 37 37 THR THR B . n B 1 38 ARG 38 38 38 ARG ARG B . n B 1 39 GLU 39 39 39 GLU GLU B . n B 1 40 GLN 40 40 40 GLN GLN B . n B 1 41 TYR 41 41 41 TYR TYR B . n B 1 42 GLU 42 42 42 GLU GLU B . n B 1 43 LYS 43 43 43 LYS LYS B . n B 1 44 MET 44 44 44 MET MET B . n B 1 45 GLN 45 45 45 GLN GLN B . n B 1 46 LYS 46 46 46 LYS LYS B . n B 1 47 ASP 47 47 47 ASP ASP B . n B 1 48 GLY 48 48 48 GLY GLY B . n B 1 49 HIS 49 49 49 HIS HIS B . n B 1 50 LEU 50 50 50 LEU LEU B . n B 1 51 LEU 51 51 51 LEU LEU B . n B 1 52 PHE 52 52 52 PHE PHE B . n B 1 53 GLY 53 53 53 GLY GLY B . n B 1 54 GLN 54 54 54 GLN GLN B . n B 1 55 VAL 55 55 55 VAL VAL B . n B 1 56 PRO 56 56 56 PRO PRO B . n B 1 57 LEU 57 57 57 LEU LEU B . n B 1 58 VAL 58 58 58 VAL VAL B . n B 1 59 GLU 59 59 59 GLU GLU B . n B 1 60 ILE 60 60 60 ILE ILE B . n B 1 61 ASP 61 61 61 ASP ASP B . n B 1 62 GLY 62 62 62 GLY GLY B . n B 1 63 MET 63 63 63 MET MET B . n B 1 64 MET 64 64 64 MET MET B . n B 1 65 LEU 65 65 65 LEU LEU B . n B 1 66 THR 66 66 66 THR THR B . n B 1 67 GLN 67 67 67 GLN GLN B . n B 1 68 THR 68 68 68 THR THR B . n B 1 69 ARG 69 69 69 ARG ARG B . n B 1 70 ALA 70 70 70 ALA ALA B . n B 1 71 ILE 71 71 71 ILE ILE B . n B 1 72 LEU 72 72 72 LEU LEU B . n B 1 73 SER 73 73 73 SER SER B . n B 1 74 TYR 74 74 74 TYR TYR B . n B 1 75 LEU 75 75 75 LEU LEU B . n B 1 76 ALA 76 76 76 ALA ALA B . n B 1 77 ALA 77 77 77 ALA ALA B . n B 1 78 LYS 78 78 78 LYS LYS B . n B 1 79 TYR 79 79 79 TYR TYR B . n B 1 80 ASN 80 80 80 ASN ASN B . n B 1 81 LEU 81 81 81 LEU LEU B . n B 1 82 TYR 82 82 82 TYR TYR B . n B 1 83 GLY 83 83 83 GLY GLY B . n B 1 84 LYS 84 84 84 LYS LYS B . n B 1 85 ASP 85 85 85 ASP ASP B . n B 1 86 LEU 86 86 86 LEU LEU B . n B 1 87 LYS 87 87 87 LYS LYS B . n B 1 88 GLU 88 88 88 GLU GLU B . n B 1 89 ARG 89 89 89 ARG ARG B . n B 1 90 VAL 90 90 90 VAL VAL B . n B 1 91 ARG 91 91 91 ARG ARG B . n B 1 92 ILE 92 92 92 ILE ILE B . n B 1 93 ASP 93 93 93 ASP ASP B . n B 1 94 MET 94 94 94 MET MET B . n B 1 95 TYR 95 95 95 TYR TYR B . n B 1 96 ALA 96 96 96 ALA ALA B . n B 1 97 ASP 97 97 97 ASP ASP B . n B 1 98 GLY 98 98 98 GLY GLY B . n B 1 99 THR 99 99 99 THR THR B . n B 1 100 GLN 100 100 100 GLN GLN B . n B 1 101 ASP 101 101 101 ASP ASP B . n B 1 102 LEU 102 102 102 LEU LEU B . n B 1 103 MET 103 103 103 MET MET B . n B 1 104 MET 104 104 104 MET MET B . n B 1 105 MET 105 105 105 MET MET B . n B 1 106 ILE 106 106 106 ILE ILE B . n B 1 107 ALA 107 107 107 ALA ALA B . n B 1 108 VAL 108 108 108 VAL VAL B . n B 1 109 ALA 109 109 109 ALA ALA B . n B 1 110 PRO 110 110 110 PRO PRO B . n B 1 111 PHE 111 111 111 PHE PHE B . n B 1 112 LYS 112 112 112 LYS LYS B . n B 1 113 THR 113 113 113 THR THR B . n B 1 114 PRO 114 114 ? ? ? B . n B 1 115 LYS 115 115 ? ? ? B . n B 1 116 GLU 116 116 ? ? ? B . n B 1 117 LYS 117 117 ? ? ? B . n B 1 118 GLU 118 118 ? ? ? B . n B 1 119 GLU 119 119 ? ? ? B . n B 1 120 SER 120 120 120 SER SER B . n B 1 121 TYR 121 121 121 TYR TYR B . n B 1 122 ASP 122 122 122 ASP ASP B . n B 1 123 LEU 123 123 123 LEU LEU B . n B 1 124 ILE 124 124 124 ILE ILE B . n B 1 125 LEU 125 125 125 LEU LEU B . n B 1 126 SER 126 126 126 SER SER B . n B 1 127 ARG 127 127 127 ARG ARG B . n B 1 128 ALA 128 128 128 ALA ALA B . n B 1 129 LYS 129 129 129 LYS LYS B . n B 1 130 THR 130 130 130 THR THR B . n B 1 131 ARG 131 131 131 ARG ARG B . n B 1 132 TYR 132 132 132 TYR TYR B . n B 1 133 PHE 133 133 133 PHE PHE B . n B 1 134 PRO 134 134 134 PRO PRO B . n B 1 135 VAL 135 135 135 VAL VAL B . n B 1 136 PHE 136 136 136 PHE PHE B . n B 1 137 GLU 137 137 137 GLU GLU B . n B 1 138 LYS 138 138 138 LYS LYS B . n B 1 139 ILE 139 139 139 ILE ILE B . n B 1 140 LEU 140 140 140 LEU LEU B . n B 1 141 LYS 141 141 141 LYS LYS B . n B 1 142 ASP 142 142 142 ASP ASP B . n B 1 143 HIS 143 143 143 HIS HIS B . n B 1 144 GLY 144 144 144 GLY GLY B . n B 1 145 GLU 145 145 145 GLU GLU B . n B 1 146 ALA 146 146 146 ALA ALA B . n B 1 147 PHE 147 147 147 PHE PHE B . n B 1 148 LEU 148 148 148 LEU LEU B . n B 1 149 VAL 149 149 149 VAL VAL B . n B 1 150 GLY 150 150 150 GLY GLY B . n B 1 151 ASN 151 151 151 ASN ASN B . n B 1 152 GLN 152 152 152 GLN GLN B . n B 1 153 LEU 153 153 153 LEU LEU B . n B 1 154 SER 154 154 154 SER SER B . n B 1 155 TRP 155 155 155 TRP TRP B . n B 1 156 ALA 156 156 156 ALA ALA B . n B 1 157 ASP 157 157 157 ASP ASP B . n B 1 158 ILE 158 158 158 ILE ILE B . n B 1 159 GLN 159 159 159 GLN GLN B . n B 1 160 LEU 160 160 160 LEU LEU B . n B 1 161 LEU 161 161 161 LEU LEU B . n B 1 162 GLU 162 162 162 GLU GLU B . n B 1 163 ALA 163 163 163 ALA ALA B . n B 1 164 ILE 164 164 164 ILE ILE B . n B 1 165 LEU 165 165 165 LEU LEU B . n B 1 166 MET 166 166 166 MET MET B . n B 1 167 VAL 167 167 167 VAL VAL B . n B 1 168 GLU 168 168 168 GLU GLU B . n B 1 169 GLU 169 169 169 GLU GLU B . n B 1 170 LEU 170 170 170 LEU LEU B . n B 1 171 SER 171 171 171 SER SER B . n B 1 172 ALA 172 172 172 ALA ALA B . n B 1 173 PRO 173 173 173 PRO PRO B . n B 1 174 VAL 174 174 174 VAL VAL B . n B 1 175 LEU 175 175 175 LEU LEU B . n B 1 176 SER 176 176 176 SER SER B . n B 1 177 ASP 177 177 177 ASP ASP B . n B 1 178 PHE 178 178 178 PHE PHE B . n B 1 179 PRO 179 179 179 PRO PRO B . n B 1 180 LEU 180 180 180 LEU LEU B . n B 1 181 LEU 181 181 181 LEU LEU B . n B 1 182 GLN 182 182 182 GLN GLN B . n B 1 183 ALA 183 183 183 ALA ALA B . n B 1 184 PHE 184 184 184 PHE PHE B . n B 1 185 LYS 185 185 185 LYS LYS B . n B 1 186 THR 186 186 186 THR THR B . n B 1 187 ARG 187 187 187 ARG ARG B . n B 1 188 ILE 188 188 188 ILE ILE B . n B 1 189 SER 189 189 189 SER SER B . n B 1 190 ASN 190 190 190 ASN ASN B . n B 1 191 ILE 191 191 191 ILE ILE B . n B 1 192 PRO 192 192 192 PRO PRO B . n B 1 193 THR 193 193 193 THR THR B . n B 1 194 ILE 194 194 194 ILE ILE B . n B 1 195 LYS 195 195 195 LYS LYS B . n B 1 196 LYS 196 196 196 LYS LYS B . n B 1 197 PHE 197 197 197 PHE PHE B . n B 1 198 LEU 198 198 198 LEU LEU B . n B 1 199 GLN 199 199 199 GLN GLN B . n B 1 200 PRO 200 200 200 PRO PRO B . n B 1 201 GLY 201 201 201 GLY GLY B . n B 1 202 SER 202 202 202 SER SER B . n B 1 203 GLN 203 203 203 GLN GLN B . n B 1 204 ARG 204 204 204 ARG ARG B . n B 1 205 LYS 205 205 205 LYS LYS B . n B 1 206 PRO 206 206 206 PRO PRO B . n B 1 207 PRO 207 207 207 PRO PRO B . n B 1 208 PRO 208 208 208 PRO PRO B . n B 1 209 ASP 209 209 209 ASP ASP B . n B 1 210 GLY 210 210 210 GLY GLY B . n B 1 211 PRO 211 211 211 PRO PRO B . n B 1 212 TYR 212 212 212 TYR TYR B . n B 1 213 VAL 213 213 213 VAL VAL B . n B 1 214 GLU 214 214 214 GLU GLU B . n B 1 215 VAL 215 215 215 VAL VAL B . n B 1 216 VAL 216 216 216 VAL VAL B . n B 1 217 ARG 217 217 217 ARG ARG B . n B 1 218 ILE 218 218 218 ILE ILE B . n B 1 219 VAL 219 219 219 VAL VAL B . n B 1 220 LEU 220 220 ? ? ? B . n B 1 221 LYS 221 221 ? ? ? B . n B 1 222 PHE 222 222 ? ? ? B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2540 ? 1 MORE -27 ? 1 'SSA (A^2)' 19500 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-04-08 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' Other 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.843 ? 1 X-PLOR refinement 3.843 ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 X-PLOR phasing 3.843 ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 9 ? ? 171.76 -178.48 2 1 ARG A 13 ? ? -80.02 -76.58 3 1 GLU A 33 ? ? -168.35 108.22 4 1 GLU A 36 ? ? -86.92 -78.90 5 1 ARG A 38 ? ? -7.27 -48.20 6 1 LEU A 51 ? ? -47.05 -71.65 7 1 MET A 64 ? ? -103.69 79.69 8 1 THR A 66 ? ? -142.39 -15.13 9 1 THR A 68 ? ? -41.62 -78.01 10 1 ASN A 80 ? ? -45.53 64.00 11 1 GLU A 145 ? ? -15.33 154.05 12 1 PRO A 173 ? ? -57.04 -77.54 13 1 VAL A 174 ? ? 57.04 -27.20 14 1 LEU A 175 ? ? -153.55 -10.40 15 1 PHE A 178 ? ? -112.56 74.77 16 1 TYR B 9 ? ? 171.65 -178.55 17 1 ARG B 13 ? ? -79.79 -75.85 18 1 GLU B 33 ? ? -168.28 109.00 19 1 GLU B 36 ? ? -87.24 -78.83 20 1 ARG B 38 ? ? -6.92 -47.94 21 1 PRO B 56 ? ? -49.81 157.50 22 1 THR B 66 ? ? -144.59 -21.79 23 1 THR B 68 ? ? -45.40 -74.88 24 1 ASN B 80 ? ? -46.61 64.99 25 1 ARG B 131 ? ? -97.72 -60.75 26 1 GLU B 145 ? ? -13.41 157.30 27 1 PRO B 173 ? ? -53.27 -76.73 28 1 VAL B 174 ? ? 55.00 -19.88 29 1 LEU B 175 ? ? -156.32 -14.98 30 1 ASP B 209 ? ? -130.72 -75.75 31 1 PRO B 211 ? ? -67.35 47.28 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 VAL A 174 ? ? LEU A 175 ? ? -147.11 2 1 PRO B 211 ? ? TYR B 212 ? ? 131.96 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 PRO A 173 ? ? 12.57 2 1 PRO B 173 ? ? 13.20 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 PHE A 178 ? ? 0.087 'SIDE CHAIN' 2 1 PHE A 184 ? ? 0.082 'SIDE CHAIN' 3 1 TYR A 212 ? ? 0.065 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A LYS 4 ? A LYS 4 5 1 Y 1 A LEU 220 ? A LEU 220 6 1 Y 1 A LYS 221 ? A LYS 221 7 1 Y 1 A PHE 222 ? A PHE 222 8 1 Y 1 B MET 1 ? B MET 1 9 1 Y 1 B ALA 2 ? B ALA 2 10 1 Y 1 B ALA 3 ? B ALA 3 11 1 Y 1 B LYS 4 ? B LYS 4 12 1 Y 1 B PRO 114 ? B PRO 114 13 1 Y 1 B LYS 115 ? B LYS 115 14 1 Y 1 B GLU 116 ? B GLU 116 15 1 Y 1 B LYS 117 ? B LYS 117 16 1 Y 1 B GLU 118 ? B GLU 118 17 1 Y 1 B GLU 119 ? B GLU 119 18 1 Y 1 B LEU 220 ? B LEU 220 19 1 Y 1 B LYS 221 ? B LYS 221 20 1 Y 1 B PHE 222 ? B PHE 222 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1GUH _pdbx_initial_refinement_model.details 'HGSTA1-1 DIMER (1GUH)' #