data_1HIC # _entry.id 1HIC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1HIC pdb_00001hic 10.2210/pdb1hic/pdb WWPDB D_1000173861 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HIC _pdbx_database_status.recvd_initial_deposition_date 1992-04-30 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Szyperski, T.' 1 'Guntert, P.' 2 'Stone, S.R.' 3 'Wuthrich, K.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Nuclear magnetic resonance solution structure of hirudin(1-51) and comparison with corresponding three-dimensional structures determined using the complete 65-residue hirudin polypeptide chain. ; J.Mol.Biol. 228 1193 1205 1992 JMOBAK UK 0022-2836 0070 ? 1335515 '10.1016/0022-2836(92)90325-E' 1 ;Impact of Protein-Protein Contacts on the Conformation of Thrombin-Bound Hirudin Studied by Comparison with the NMR Solution Structure of Hirudin(1-51) ; J.Mol.Biol. 228 1206 ? 1992 JMOBAK UK 0022-2836 0070 ? ? ? 2 'Conformation of Recombinant Desulfatohirudin in Aqueous Solution Determined by Nuclear Magnetic Resonance' Biochemistry 28 4301 ? 1989 BICHAW US 0006-2960 0033 ? ? ? 3 ;Solution Structure of Recombinant Hirudin and the Lys 47-Glu Mutant: A Nuclear Magnetic Resonance and Hybrid Geometry-Dynamical Simulated Annealing Study ; Biochemistry 28 2601 ? 1989 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Szyperski, T.' 1 ? primary 'Guntert, P.' 2 ? primary 'Stone, S.R.' 3 ? primary 'Wuthrich, K.' 4 ? 1 'Szyperski, T.' 5 ? 1 'Guntert, P.' 6 ? 1 'Tulinsky, A.' 7 ? 1 'Bode, W.' 8 ? 1 'Huber, R.' 9 ? 1 'Wuthrich, K.' 10 ? 2 'Haruyama, H.' 11 ? 2 'Wuthrich, K.' 12 ? 3 'Folkers, P.J.M.' 13 ? 3 'Clore, G.M.' 14 ? 3 'Driscoll, P.C.' 15 ? 3 'Dodt, J.' 16 ? 3 'Kohler, S.' 17 ? 3 'Gronenborn, A.M.' 18 ? # _cell.entry_id 1HIC _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1HIC _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'HIRUDIN VARIANT' _entity.formula_weight 5293.813 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSH _entity_poly.pdbx_seq_one_letter_code_can VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 VAL n 1 3 TYR n 1 4 THR n 1 5 ASP n 1 6 CYS n 1 7 THR n 1 8 GLU n 1 9 SER n 1 10 GLY n 1 11 GLN n 1 12 ASN n 1 13 LEU n 1 14 CYS n 1 15 LEU n 1 16 CYS n 1 17 GLU n 1 18 GLY n 1 19 SER n 1 20 ASN n 1 21 VAL n 1 22 CYS n 1 23 GLY n 1 24 GLN n 1 25 GLY n 1 26 ASN n 1 27 LYS n 1 28 CYS n 1 29 ILE n 1 30 LEU n 1 31 GLY n 1 32 SER n 1 33 ASP n 1 34 GLY n 1 35 GLU n 1 36 LYS n 1 37 ASN n 1 38 GLN n 1 39 CYS n 1 40 VAL n 1 41 THR n 1 42 GLY n 1 43 GLU n 1 44 GLY n 1 45 THR n 1 46 PRO n 1 47 LYS n 1 48 PRO n 1 49 GLN n 1 50 SER n 1 51 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'medicinal leech' _entity_src_gen.gene_src_genus Hirudo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Hirudo medicinalis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6421 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ITH1_HIRME _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01050 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1HIC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 51 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01050 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 51 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 51 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1HIC _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement DIANA ? GUNTERT,BRAUN,WUTHRICH 1 refinement Amber 3.0 SINGH,WEINER,CALDWELL,KOLLMAN 2 # _exptl.entry_id 1HIC _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1HIC _struct.title ;THE NMR SOLUTION STRUCTURE OF HIRUDIN(1-51) AND COMPARISON WITH CORRESPONDING THREE-DIMENSIONAL STRUCTURES DETERMINED USING THE COMPLETE 65-RESIDUE HIRUDIN POLYPEPTIDE CHAIN ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1HIC _struct_keywords.pdbx_keywords HIRUDIN _struct_keywords.text HIRUDIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 14 SG ? ? A CYS 6 A CYS 14 1_555 ? ? ? ? ? ? ? 2.067 ? ? disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 16 A CYS 28 1_555 ? ? ? ? ? ? ? 2.162 ? ? disulf3 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 22 A CYS 39 1_555 ? ? ? ? ? ? ? 2.088 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details 1 ? 2 ? 2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense 1 1 2 ? anti-parallel 2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id 1 1 CYS A 14 ? CYS A 16 ? CYS A 14 CYS A 16 1 2 ASN A 20 ? CYS A 22 ? ASN A 20 CYS A 22 2 1 LYS A 27 ? GLY A 31 ? LYS A 27 GLY A 31 2 2 LYS A 36 ? VAL A 40 ? LYS A 36 VAL A 40 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id 1 1 2 N CYS A 14 ? N CYS A 14 O CYS A 22 ? O CYS A 22 2 1 2 O ILE A 29 ? O ILE A 29 N GLN A 38 ? N GLN A 38 # _database_PDB_matrix.entry_id 1HIC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1HIC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_sites_footnote.id _atom_sites_footnote.text 1 'SER 32 - ASP 33 MODEL 1 OMEGA =218.49 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 2 'SER 32 - ASP 33 MODEL 10 OMEGA =215.83 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 3 'SER 32 - ASP 33 MODEL 15 OMEGA =219.86 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 HIS 51 51 51 HIS HIS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-01-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 CA A CYS 14 ? ? CB A CYS 14 ? ? SG A CYS 14 ? ? 121.72 114.20 7.52 1.10 N 2 4 CA A CYS 14 ? ? CB A CYS 14 ? ? SG A CYS 14 ? ? 122.63 114.20 8.43 1.10 N 3 9 CA A CYS 6 ? ? CB A CYS 6 ? ? SG A CYS 6 ? ? 121.49 114.20 7.29 1.10 N 4 9 CA A CYS 14 ? ? CB A CYS 14 ? ? SG A CYS 14 ? ? 121.21 114.20 7.01 1.10 N 5 10 CA A CYS 14 ? ? CB A CYS 14 ? ? SG A CYS 14 ? ? 121.28 114.20 7.08 1.10 N 6 11 CA A CYS 14 ? ? CB A CYS 14 ? ? SG A CYS 14 ? ? 121.03 114.20 6.83 1.10 N 7 17 CA A CYS 14 ? ? CB A CYS 14 ? ? SG A CYS 14 ? ? 121.44 114.20 7.24 1.10 N 8 20 CA A CYS 14 ? ? CB A CYS 14 ? ? SG A CYS 14 ? ? 121.78 114.20 7.58 1.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 16 ? ? -143.14 -63.06 2 1 ASP A 33 ? ? 153.09 34.87 3 1 SER A 50 ? ? 61.19 144.58 4 3 GLU A 8 ? ? -176.12 145.80 5 3 CYS A 16 ? ? -109.94 -63.72 6 3 SER A 32 ? ? -101.35 69.96 7 3 GLN A 49 ? ? -48.87 158.04 8 3 SER A 50 ? ? -150.28 67.11 9 4 CYS A 16 ? ? -95.23 -64.43 10 4 SER A 32 ? ? -144.34 43.22 11 4 ASP A 33 ? ? 170.27 37.04 12 4 GLU A 43 ? ? -170.21 147.35 13 4 SER A 50 ? ? 65.45 168.80 14 5 SER A 50 ? ? 67.23 91.16 15 6 CYS A 16 ? ? -131.14 -63.76 16 6 SER A 50 ? ? -101.33 -60.72 17 7 CYS A 16 ? ? -142.07 -64.15 18 7 ASP A 33 ? ? 95.75 73.44 19 8 SER A 32 ? ? -157.45 72.31 20 9 CYS A 16 ? ? -131.90 -68.40 21 9 GLU A 43 ? ? 68.49 144.95 22 9 SER A 50 ? ? 74.09 151.56 23 10 CYS A 16 ? ? -106.94 -63.36 24 10 SER A 32 ? ? -143.67 42.09 25 10 ASP A 33 ? ? 160.09 28.38 26 10 GLU A 43 ? ? 42.11 83.75 27 11 THR A 7 ? ? -134.45 -39.21 28 11 LEU A 13 ? ? 71.38 38.50 29 11 CYS A 16 ? ? -120.69 -63.98 30 11 SER A 32 ? ? -101.83 67.67 31 12 CYS A 16 ? ? -127.66 -62.93 32 13 LEU A 13 ? ? 74.73 53.36 33 13 CYS A 16 ? ? -139.21 -63.24 34 13 ASP A 33 ? ? 38.74 67.39 35 13 GLU A 43 ? ? 58.50 144.90 36 13 GLN A 49 ? ? -44.24 151.53 37 14 CYS A 16 ? ? -107.32 -63.17 38 14 LEU A 30 ? ? -69.73 73.91 39 14 ASP A 33 ? ? 49.63 28.02 40 14 SER A 50 ? ? 67.48 -75.64 41 15 CYS A 16 ? ? -127.64 -63.64 42 15 ASP A 33 ? ? 152.89 28.42 43 15 GLU A 43 ? ? 72.06 83.51 44 15 SER A 50 ? ? -172.93 -64.77 45 16 CYS A 16 ? ? -138.89 -63.20 46 16 SER A 32 ? ? -176.38 94.61 47 16 GLU A 43 ? ? 73.68 154.97 48 16 SER A 50 ? ? 63.64 162.15 49 17 LEU A 15 ? ? -57.68 108.88 50 17 CYS A 16 ? ? -99.18 -63.15 51 17 ASP A 33 ? ? 164.07 49.72 52 17 LYS A 47 ? ? -50.77 108.23 53 18 THR A 7 ? ? -141.35 28.00 54 18 CYS A 16 ? ? -142.31 -64.57 55 18 ASP A 33 ? ? 78.05 61.76 56 18 SER A 50 ? ? 67.86 174.46 57 19 CYS A 16 ? ? -123.07 -63.43 58 19 ASP A 33 ? ? 87.38 61.49 59 20 CYS A 16 ? ? -140.84 -63.94 60 20 SER A 50 ? ? -163.58 -41.57 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 SER A 32 ? ? ASP A 33 ? ? -141.51 2 10 SER A 32 ? ? ASP A 33 ? ? -144.17 3 15 SER A 32 ? ? ASP A 33 ? ? -140.14 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 7 TYR A 3 ? ? 0.067 'SIDE CHAIN' 2 11 TYR A 3 ? ? 0.070 'SIDE CHAIN' 3 17 TYR A 3 ? ? 0.079 'SIDE CHAIN' 4 19 TYR A 3 ? ? 0.072 'SIDE CHAIN' #