data_1HIQ # _entry.id 1HIQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1HIQ WWPDB D_1000173873 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HIQ _pdbx_database_status.recvd_initial_deposition_date 1993-03-05 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hua, Q.X.' 1 'Shoelson, S.E.' 2 'Inouye, K.' 3 'Weiss, M.A.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Paradoxical structure and function in a mutant human insulin associated with diabetes mellitus.' Proc.Natl.Acad.Sci.USA 90 582 586 1993 PNASA6 US 0027-8424 0040 ? 8421693 10.1073/pnas.90.2.582 1 'Structure and Dynamics of Des-Pentapeptide-Insulin in Solution: The Molten-Globule Hypothesis' Proc.Natl.Acad.Sci.USA 89 2379 ? 1992 PNASA6 US 0027-8424 0040 ? ? ? 2 'Receptor Binding Redefined by a Structural Switch in a Mutant Human Insulin' Nature 354 238 ? 1991 NATUAS UK 0028-0836 0006 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Hua, Q.X.' 1 primary 'Shoelson, S.E.' 2 primary 'Inouye, K.' 3 primary 'Weiss, M.A.' 4 1 'Hua, Q.-X.' 5 1 'Kochoyan, M.' 6 1 'Weiss, M.A.' 7 2 'Hua, Q.X.' 8 2 'Shoelson, S.E.' 9 2 'Kochoyan, M.' 10 2 'Weiss, M.A.' 11 # _cell.entry_id 1HIQ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1HIQ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man INSULIN 2383.698 1 ? ? ? ? 2 polymer man INSULIN 3373.857 1 ? F24S ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN A ? 2 'polypeptide(L)' no no FVNQHLCGSHLVEALYLVCGERGSFYTPKT FVNQHLCGSHLVEALYLVCGERGSFYTPKT B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 VAL n 1 4 GLU n 1 5 GLN n 1 6 CYS n 1 7 CYS n 1 8 THR n 1 9 SER n 1 10 ILE n 1 11 CYS n 1 12 SER n 1 13 LEU n 1 14 TYR n 1 15 GLN n 1 16 LEU n 1 17 GLU n 1 18 ASN n 1 19 TYR n 1 20 CYS n 1 21 ASN n 2 1 PHE n 2 2 VAL n 2 3 ASN n 2 4 GLN n 2 5 HIS n 2 6 LEU n 2 7 CYS n 2 8 GLY n 2 9 SER n 2 10 HIS n 2 11 LEU n 2 12 VAL n 2 13 GLU n 2 14 ALA n 2 15 LEU n 2 16 TYR n 2 17 LEU n 2 18 VAL n 2 19 CYS n 2 20 GLY n 2 21 GLU n 2 22 ARG n 2 23 GLY n 2 24 SER n 2 25 PHE n 2 26 TYR n 2 27 THR n 2 28 PRO n 2 29 LYS n 2 30 THR n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? PANCREAS ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_align_begin _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_db_isoform 1 UNP INS_HUMAN P01308 1 90 ? ? 2 UNP INS_HUMAN P01308 2 25 ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1HIQ A 1 ? 21 ? P01308 90 ? 110 ? 1 21 2 2 1HIQ B 1 ? 30 ? P01308 25 ? 54 ? 1 30 # _struct_ref_seq_dif.align_id 2 _struct_ref_seq_dif.pdbx_pdb_id_code 1HIQ _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id B _struct_ref_seq_dif.seq_num 24 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P01308 _struct_ref_seq_dif.db_mon_id PHE _struct_ref_seq_dif.pdbx_seq_db_seq_num 48 _struct_ref_seq_dif.details 'ENGINEERED MUTATION' _struct_ref_seq_dif.pdbx_auth_seq_num 24 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1HIQ _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement DGII ? HAVEL 1 refinement X-PLOR ? BRUNGER 2 # _exptl.entry_id 1HIQ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1HIQ _struct.title 'PARADOXICAL STRUCTURE AND FUNCTION IN A MUTANT HUMAN INSULIN ASSOCIATED WITH DIABETES MELLITUS' _struct.pdbx_descriptor 'INSULIN (HUMAN) MUTANT WITH PHE B 24 REPLACED BY SER (F24S) (NMR, REPRESENTATIVE PLUS 9 STRUCTURES)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1HIQ _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text HORMONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 ILE A 2 ? THR A 8 ? ILE A 2 THR A 8 1 ? 7 HELX_P HELX_P2 H2 SER A 12 ? ASN A 18 ? SER A 12 ASN A 18 1 ? 7 HELX_P HELX_P3 H3 SER B 9 ? CYS B 19 ? SER B 9 CYS B 19 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 6 A CYS 11 1_555 ? ? ? ? ? ? ? 2.020 ? disulf2 disulf ? ? A CYS 7 SG ? ? ? 1_555 B CYS 7 SG ? ? A CYS 7 B CYS 7 1_555 ? ? ? ? ? ? ? 2.020 ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 19 1_555 ? ? ? ? ? ? ? 2.019 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1HIQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1HIQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_sites_footnote.id _atom_sites_footnote.text 1 'THR B 27 - PRO B 28 MODEL 2 OMEGA =213.93 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 2 'THR B 27 - PRO B 28 MODEL 9 OMEGA =213.50 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ASN 21 21 21 ASN ASN A . n B 2 1 PHE 1 1 1 PHE PHE B . n B 2 2 VAL 2 2 2 VAL VAL B . n B 2 3 ASN 3 3 3 ASN ASN B . n B 2 4 GLN 4 4 4 GLN GLN B . n B 2 5 HIS 5 5 5 HIS HIS B . n B 2 6 LEU 6 6 6 LEU LEU B . n B 2 7 CYS 7 7 7 CYS CYS B . n B 2 8 GLY 8 8 8 GLY GLY B . n B 2 9 SER 9 9 9 SER SER B . n B 2 10 HIS 10 10 10 HIS HIS B . n B 2 11 LEU 11 11 11 LEU LEU B . n B 2 12 VAL 12 12 12 VAL VAL B . n B 2 13 GLU 13 13 13 GLU GLU B . n B 2 14 ALA 14 14 14 ALA ALA B . n B 2 15 LEU 15 15 15 LEU LEU B . n B 2 16 TYR 16 16 16 TYR TYR B . n B 2 17 LEU 17 17 17 LEU LEU B . n B 2 18 VAL 18 18 18 VAL VAL B . n B 2 19 CYS 19 19 19 CYS CYS B . n B 2 20 GLY 20 20 20 GLY GLY B . n B 2 21 GLU 21 21 21 GLU GLU B . n B 2 22 ARG 22 22 22 ARG ARG B . n B 2 23 GLY 23 23 23 GLY GLY B . n B 2 24 SER 24 24 24 SER SER B . n B 2 25 PHE 25 25 25 PHE PHE B . n B 2 26 TYR 26 26 26 TYR TYR B . n B 2 27 THR 27 27 27 THR THR B . n B 2 28 PRO 28 28 28 PRO PRO B . n B 2 29 LYS 29 29 29 LYS LYS B . n B 2 30 THR 30 30 30 THR THR B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-01-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' struct_conf 3 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 4 _pdbx_validate_close_contact.auth_atom_id_1 HG _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 24 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HG1 _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 THR _pdbx_validate_close_contact.auth_seq_id_2 30 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.30 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A TYR 19 ? ? CG A TYR 19 ? ? CD2 A TYR 19 ? ? 116.83 121.00 -4.17 0.60 N 2 1 CB A TYR 19 ? ? CG A TYR 19 ? ? CD1 A TYR 19 ? ? 124.86 121.00 3.86 0.60 N 3 1 CA B CYS 19 ? ? CB B CYS 19 ? ? SG B CYS 19 ? ? 122.46 114.20 8.26 1.10 N 4 1 NE B ARG 22 ? ? CZ B ARG 22 ? ? NH1 B ARG 22 ? ? 116.77 120.30 -3.53 0.50 N 5 4 CB B TYR 26 ? ? CG B TYR 26 ? ? CD2 B TYR 26 ? ? 117.30 121.00 -3.70 0.60 N 6 5 NE B ARG 22 ? ? CZ B ARG 22 ? ? NH2 B ARG 22 ? ? 116.02 120.30 -4.28 0.50 N 7 6 CA A CYS 20 ? ? CB A CYS 20 ? ? SG A CYS 20 ? ? 121.16 114.20 6.96 1.10 N 8 9 CA A CYS 11 ? ? CB A CYS 11 ? ? SG A CYS 11 ? ? 120.94 114.20 6.74 1.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 2 ? ? -27.70 -53.71 2 1 GLU A 4 ? ? -25.92 -52.39 3 1 CYS A 7 ? ? -121.00 -53.51 4 1 SER A 9 ? ? -125.19 -161.84 5 1 GLU A 17 ? ? -25.79 -51.03 6 1 CYS A 20 ? ? -28.09 -60.88 7 1 VAL B 2 ? ? -115.35 59.19 8 1 VAL B 18 ? ? -103.27 -78.93 9 1 PHE B 25 ? ? -113.41 -96.84 10 1 THR B 27 ? ? -118.36 57.99 11 2 CYS A 6 ? ? -86.54 32.48 12 2 GLU A 17 ? ? -28.35 -42.14 13 2 CYS A 20 ? ? -65.67 -176.67 14 2 VAL B 2 ? ? -117.35 70.85 15 2 ASN B 3 ? ? 9.64 55.11 16 2 LEU B 6 ? ? -106.66 -81.32 17 2 CYS B 7 ? ? 76.92 -70.71 18 2 VAL B 18 ? ? -89.80 -73.43 19 2 CYS B 19 ? ? -126.92 -89.91 20 2 SER B 24 ? ? -19.29 164.89 21 2 THR B 27 ? ? -143.49 -62.11 22 3 GLU A 4 ? ? -21.44 -57.94 23 3 CYS A 11 ? ? -122.25 -168.37 24 3 CYS A 20 ? ? -118.75 -168.34 25 3 ASN B 3 ? ? -102.78 63.89 26 3 SER B 9 ? ? -130.65 -35.46 27 3 CYS B 19 ? ? -106.15 55.80 28 3 LYS B 29 ? ? -147.96 59.92 29 4 VAL A 3 ? ? -79.83 31.27 30 4 GLN A 5 ? ? -108.27 -63.38 31 4 GLU A 17 ? ? -26.32 -42.70 32 4 ASN A 18 ? ? -27.75 -44.39 33 4 CYS A 20 ? ? -35.82 169.23 34 4 ASN B 3 ? ? -105.20 41.32 35 4 SER B 9 ? ? -141.59 -41.51 36 4 VAL B 18 ? ? -103.63 -67.26 37 4 GLU B 21 ? ? 104.15 -44.55 38 4 ARG B 22 ? ? 19.75 50.87 39 4 SER B 24 ? ? 7.62 86.43 40 4 PHE B 25 ? ? 5.26 -74.30 41 4 THR B 27 ? ? -6.68 -53.31 42 4 PRO B 28 ? ? -21.52 -59.77 43 5 GLU A 4 ? ? -23.00 -40.73 44 5 CYS A 7 ? ? -122.39 -55.74 45 5 THR A 8 ? ? -109.97 68.32 46 5 SER A 9 ? ? 122.66 -175.02 47 5 TYR A 19 ? ? -121.84 -51.02 48 5 CYS A 20 ? ? -16.05 80.55 49 5 ASN B 3 ? ? -119.19 51.60 50 5 HIS B 10 ? ? -26.59 -52.50 51 5 CYS B 19 ? ? -140.66 -70.64 52 5 PHE B 25 ? ? -141.54 40.13 53 5 TYR B 26 ? ? 103.57 79.60 54 5 PRO B 28 ? ? -54.41 80.41 55 5 LYS B 29 ? ? -107.92 50.65 56 6 VAL A 3 ? ? -104.74 49.85 57 6 SER A 9 ? ? -128.15 -153.93 58 6 CYS A 20 ? ? -116.47 77.29 59 6 VAL B 2 ? ? -108.03 62.20 60 6 ASN B 3 ? ? -21.89 85.30 61 6 CYS B 7 ? ? 109.56 37.62 62 6 SER B 9 ? ? 144.26 -9.42 63 6 CYS B 19 ? ? -144.47 -67.49 64 6 GLU B 21 ? ? 34.20 58.77 65 6 ARG B 22 ? ? -111.35 59.03 66 6 SER B 24 ? ? 15.02 -70.77 67 6 PHE B 25 ? ? -105.32 51.48 68 6 PRO B 28 ? ? -10.45 -67.63 69 6 LYS B 29 ? ? -140.82 37.27 70 7 ILE A 2 ? ? -107.64 -80.07 71 7 CYS A 6 ? ? -65.11 4.98 72 7 SER A 9 ? ? -134.12 -159.38 73 7 CYS A 20 ? ? -115.00 -166.16 74 7 ASN B 3 ? ? -112.86 55.49 75 7 CYS B 7 ? ? -119.47 75.10 76 7 CYS B 19 ? ? -107.06 52.93 77 7 GLU B 21 ? ? -135.94 -50.46 78 7 PHE B 25 ? ? -113.61 59.23 79 8 VAL A 3 ? ? -28.60 -46.08 80 8 GLU A 4 ? ? -26.41 -41.89 81 8 GLU A 17 ? ? -27.02 -42.24 82 8 CYS A 20 ? ? -45.23 156.67 83 8 TYR B 16 ? ? -36.95 -37.64 84 8 LYS B 29 ? ? -116.47 66.85 85 9 VAL A 3 ? ? -96.74 41.09 86 9 LEU A 13 ? ? -28.57 -57.22 87 9 GLU A 17 ? ? -28.85 -38.15 88 9 ASN A 18 ? ? -24.61 -42.01 89 9 ASN B 3 ? ? -110.51 64.57 90 9 CYS B 7 ? ? -130.87 -149.63 91 9 VAL B 18 ? ? -93.39 -69.13 92 9 CYS B 19 ? ? -120.01 -60.09 93 9 GLU B 21 ? ? -95.13 53.57 94 9 SER B 24 ? ? -118.47 78.55 95 9 PRO B 28 ? ? -24.24 -53.35 96 10 CYS A 6 ? ? -92.78 34.92 97 10 GLU A 17 ? ? -33.58 -35.68 98 10 ASN A 18 ? ? -31.78 -38.02 99 10 CYS A 20 ? ? -18.85 -55.97 100 10 ASN B 3 ? ? -115.60 54.92 101 10 GLU B 21 ? ? 40.49 82.91 102 10 SER B 24 ? ? 5.65 -75.62 103 10 THR B 27 ? ? 4.85 82.66 104 10 PRO B 28 ? ? -53.80 103.79 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 2 THR B 27 ? ? PRO B 28 ? ? -146.07 2 9 THR B 27 ? ? PRO B 28 ? ? -146.50 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG B 22 ? ? 0.314 'SIDE CHAIN' 2 2 ARG B 22 ? ? 0.278 'SIDE CHAIN' 3 3 ARG B 22 ? ? 0.308 'SIDE CHAIN' 4 4 ARG B 22 ? ? 0.287 'SIDE CHAIN' 5 5 ARG B 22 ? ? 0.140 'SIDE CHAIN' 6 6 ARG B 22 ? ? 0.198 'SIDE CHAIN' 7 7 ARG B 22 ? ? 0.309 'SIDE CHAIN' 8 8 ARG B 22 ? ? 0.303 'SIDE CHAIN' 9 9 ARG B 22 ? ? 0.136 'SIDE CHAIN' 10 10 ARG B 22 ? ? 0.261 'SIDE CHAIN' #