data_1HLS # _entry.id 1HLS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1HLS pdb_00001hls 10.2210/pdb1hls/pdb WWPDB D_1000173902 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-09-15 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 5 'Structure model' 1 4 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 4 'Structure model' struct_conf_type 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature 11 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' 4 5 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HLS _pdbx_database_status.recvd_initial_deposition_date 1995-06-28 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ludvigsen, S.' 1 'Kaarsholm, N.C.' 2 # _citation.id primary _citation.title ;High-resolution structure of an engineered biologically potent insulin monomer, B16 Tyr-->His, as determined by nuclear magnetic resonance spectroscopy. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 33 _citation.page_first 7998 _citation.page_last 8006 _citation.year 1994 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 8025104 _citation.pdbx_database_id_DOI 10.1021/bi00192a003 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ludvigsen, S.' 1 ? primary 'Roy, M.' 2 ? primary 'Thogersen, H.' 3 ? primary 'Kaarsholm, N.C.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man INSULIN 2383.698 1 ? 'TYR 16 B HIS' ? ? 2 polymer man INSULIN 3408.926 1 ? 'TYR 16 B HIS' ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN A ? 2 'polypeptide(L)' no no FVNQHLCGSHLVEALHLVCGERGFFYTPKT FVNQHLCGSHLVEALHLVCGERGFFYTPKT B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 VAL n 1 4 GLU n 1 5 GLN n 1 6 CYS n 1 7 CYS n 1 8 THR n 1 9 SER n 1 10 ILE n 1 11 CYS n 1 12 SER n 1 13 LEU n 1 14 TYR n 1 15 GLN n 1 16 LEU n 1 17 GLU n 1 18 ASN n 1 19 TYR n 1 20 CYS n 1 21 ASN n 2 1 PHE n 2 2 VAL n 2 3 ASN n 2 4 GLN n 2 5 HIS n 2 6 LEU n 2 7 CYS n 2 8 GLY n 2 9 SER n 2 10 HIS n 2 11 LEU n 2 12 VAL n 2 13 GLU n 2 14 ALA n 2 15 LEU n 2 16 HIS n 2 17 LEU n 2 18 VAL n 2 19 CYS n 2 20 GLY n 2 21 GLU n 2 22 ARG n 2 23 GLY n 2 24 PHE n 2 25 PHE n 2 26 TYR n 2 27 THR n 2 28 PRO n 2 29 LYS n 2 30 THR n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? PANCREAS ? ? ? ;baker's yeast ; 'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? PANCREAS ? ? ? ;baker's yeast ; 'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ASN 21 21 21 ASN ASN A . n B 2 1 PHE 1 1 1 PHE PHE B . n B 2 2 VAL 2 2 2 VAL VAL B . n B 2 3 ASN 3 3 3 ASN ASN B . n B 2 4 GLN 4 4 4 GLN GLN B . n B 2 5 HIS 5 5 5 HIS HIS B . n B 2 6 LEU 6 6 6 LEU LEU B . n B 2 7 CYS 7 7 7 CYS CYS B . n B 2 8 GLY 8 8 8 GLY GLY B . n B 2 9 SER 9 9 9 SER SER B . n B 2 10 HIS 10 10 10 HIS HIS B . n B 2 11 LEU 11 11 11 LEU LEU B . n B 2 12 VAL 12 12 12 VAL VAL B . n B 2 13 GLU 13 13 13 GLU GLU B . n B 2 14 ALA 14 14 14 ALA ALA B . n B 2 15 LEU 15 15 15 LEU LEU B . n B 2 16 HIS 16 16 16 HIS HIS B . n B 2 17 LEU 17 17 17 LEU LEU B . n B 2 18 VAL 18 18 18 VAL VAL B . n B 2 19 CYS 19 19 19 CYS CYS B . n B 2 20 GLY 20 20 20 GLY GLY B . n B 2 21 GLU 21 21 21 GLU GLU B . n B 2 22 ARG 22 22 22 ARG ARG B . n B 2 23 GLY 23 23 23 GLY GLY B . n B 2 24 PHE 24 24 24 PHE PHE B . n B 2 25 PHE 25 25 25 PHE PHE B . n B 2 26 TYR 26 26 26 TYR TYR B . n B 2 27 THR 27 27 27 THR THR B . n B 2 28 PRO 28 28 28 PRO PRO B . n B 2 29 LYS 29 29 29 LYS LYS B . n B 2 30 THR 30 30 30 THR THR B . n # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.0 ? 1 X-PLOR refinement 3.0 ? 2 X-PLOR phasing 3.0 ? 3 # _cell.entry_id 1HLS _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1HLS _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1HLS _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1HLS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1HLS _struct.title 'NMR STRUCTURE OF THE HUMAN INSULIN-HIS(B16)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1HLS _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text HORMONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform _struct_ref.pdbx_seq_one_letter_code 1 UNP INS_HUMAN P01308 1 90 ? ? 2 UNP INS_HUMAN P01308 2 25 ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1HLS A 1 ? 21 ? P01308 90 ? 110 ? 1 21 2 2 1HLS B 1 ? 30 ? P01308 25 ? 54 ? 1 30 # _struct_ref_seq_dif.align_id 2 _struct_ref_seq_dif.pdbx_pdb_id_code 1HLS _struct_ref_seq_dif.mon_id HIS _struct_ref_seq_dif.pdbx_pdb_strand_id B _struct_ref_seq_dif.seq_num 16 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P01308 _struct_ref_seq_dif.db_mon_id TYR _struct_ref_seq_dif.pdbx_seq_db_seq_num 40 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 16 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 ILE A 2 ? SER A 9 ? ILE A 2 SER A 9 1 ? 8 HELX_P HELX_P2 H2 SER A 12 ? TYR A 19 ? SER A 12 TYR A 19 1 ? 8 HELX_P HELX_P3 H3 SER B 9 ? CYS B 19 ? SER B 9 CYS B 19 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 6 A CYS 11 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf2 disulf ? ? A CYS 7 SG ? ? ? 1_555 B CYS 7 SG ? ? A CYS 7 B CYS 7 1_555 ? ? ? ? ? ? ? 2.018 ? ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 19 1_555 ? ? ? ? ? ? ? 2.018 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 6 ? CYS A 11 ? CYS A 6 ? 1_555 CYS A 11 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 7 ? CYS B 7 ? CYS A 7 ? 1_555 CYS B 7 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 20 ? CYS B 19 ? CYS A 20 ? 1_555 CYS B 19 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 1HLS _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN B 3 ? ? -62.84 88.45 2 1 CYS B 19 ? ? -102.11 -68.73 3 1 PRO B 28 ? ? -62.94 -168.38 4 1 LYS B 29 ? ? -150.99 -38.22 5 2 CYS A 11 ? ? -123.02 -168.15 6 2 TYR A 19 ? ? -85.91 49.68 7 2 CYS B 19 ? ? -91.11 -82.47 8 2 ARG B 22 ? ? -52.40 -79.53 9 2 PHE B 24 ? ? -170.06 133.46 10 3 VAL A 3 ? ? -37.37 -34.80 11 3 GLU A 4 ? ? -85.67 43.39 12 3 GLN A 5 ? ? -169.96 -52.61 13 3 CYS A 6 ? ? -92.53 33.21 14 3 CYS A 7 ? ? -141.48 -63.47 15 3 CYS B 19 ? ? -116.30 -86.98 16 3 ARG B 22 ? ? -80.11 -74.92 17 3 PHE B 25 ? ? -116.61 69.77 18 3 LYS B 29 ? ? -172.03 34.59 19 4 GLU A 4 ? ? -83.22 37.80 20 4 GLN A 5 ? ? -150.24 -51.65 21 4 SER A 9 ? ? -121.57 -149.49 22 4 PRO B 28 ? ? -61.13 90.46 23 5 CYS A 6 ? ? -97.00 -70.51 24 5 SER A 9 ? ? -137.53 -136.78 25 5 CYS B 19 ? ? -113.48 -87.01 26 6 GLN A 5 ? ? -153.65 -55.32 27 6 SER A 9 ? ? -159.47 -159.92 28 6 CYS B 19 ? ? -97.79 -60.78 29 6 PHE B 25 ? ? -102.72 75.28 30 6 PRO B 28 ? ? -60.38 -170.20 31 7 SER A 9 ? ? -152.37 -138.23 32 7 CYS B 19 ? ? -88.39 -86.47 33 7 ARG B 22 ? ? -55.51 -73.39 34 7 LYS B 29 ? ? -165.04 101.63 35 8 CYS A 7 ? ? -77.69 -75.10 36 8 SER A 9 ? ? -112.40 -156.47 37 8 TYR A 19 ? ? -84.47 43.04 38 8 CYS B 19 ? ? -78.87 -70.09 39 8 PRO B 28 ? ? -57.61 -170.84 40 8 LYS B 29 ? ? -151.27 47.41 41 9 VAL A 3 ? ? -37.82 -33.31 42 9 GLU A 4 ? ? -85.78 43.05 43 9 GLN A 5 ? ? -171.68 -49.08 44 9 CYS A 11 ? ? -79.59 -158.60 45 9 CYS B 19 ? ? -103.74 -99.68 46 9 PRO B 28 ? ? -61.02 82.71 47 10 VAL A 3 ? ? -34.74 -35.40 48 10 GLU A 4 ? ? -87.41 43.43 49 10 GLN A 5 ? ? -171.92 -36.86 50 10 CYS A 11 ? ? -59.07 -174.46 51 10 TYR A 19 ? ? -84.98 46.79 52 10 CYS B 19 ? ? -89.28 -77.37 53 11 GLU A 4 ? ? -84.45 44.76 54 11 GLN A 5 ? ? -165.86 -38.75 55 11 CYS A 11 ? ? -67.47 -177.64 56 11 TYR A 19 ? ? -82.22 44.17 57 11 LEU B 6 ? ? -118.50 76.23 58 11 CYS B 19 ? ? -70.96 -72.72 59 11 GLU B 21 ? ? -42.29 -72.49 60 11 PRO B 28 ? ? -59.60 -176.14 61 12 GLU A 4 ? ? -35.16 -30.34 62 12 CYS A 6 ? ? -83.32 42.98 63 12 CYS A 7 ? ? -142.20 -66.48 64 12 SER A 9 ? ? -151.54 -159.78 65 12 CYS A 11 ? ? -108.99 -157.45 66 12 ASN B 3 ? ? -64.15 92.82 67 12 CYS B 19 ? ? -99.39 -71.83 68 12 THR B 27 ? ? -116.79 76.63 69 12 PRO B 28 ? ? -59.01 -170.53 70 13 GLU A 4 ? ? -85.95 45.74 71 13 GLN A 5 ? ? -161.38 -39.91 72 13 SER A 9 ? ? -116.87 -97.57 73 13 GLN B 4 ? ? -116.92 -161.41 74 13 LEU B 6 ? ? -101.62 76.55 75 14 SER A 9 ? ? -107.40 -146.92 76 14 CYS A 11 ? ? -66.68 -174.80 77 14 TYR A 19 ? ? -80.79 35.78 78 14 GLN B 4 ? ? -144.73 -151.39 79 14 CYS B 19 ? ? -108.27 -74.45 80 14 PRO B 28 ? ? -61.66 96.66 81 15 VAL A 3 ? ? -38.47 -34.26 82 15 GLU A 4 ? ? -85.82 48.43 83 15 GLN A 5 ? ? -178.49 -33.05 84 15 SER A 9 ? ? -165.97 -154.12 85 15 CYS B 19 ? ? -113.25 -93.00 86 15 PRO B 28 ? ? -60.08 92.27 87 16 GLU A 4 ? ? -85.32 46.18 88 16 GLN A 5 ? ? -171.31 -36.53 89 16 SER A 9 ? ? -135.31 -142.22 90 16 CYS A 11 ? ? -75.82 -168.46 91 16 TYR A 19 ? ? -84.37 47.51 92 16 CYS B 19 ? ? -95.09 -85.44 93 16 PRO B 28 ? ? -65.24 80.71 94 17 GLU A 4 ? ? -85.14 45.82 95 17 GLN A 5 ? ? -174.32 -61.20 96 17 CYS A 7 ? ? -76.59 -73.93 97 17 CYS B 19 ? ? -96.37 -73.92 98 17 PRO B 28 ? ? -60.06 -167.29 99 17 LYS B 29 ? ? -165.20 83.82 100 18 VAL A 3 ? ? -38.79 -32.92 101 18 GLU A 4 ? ? -85.51 41.60 102 18 GLN A 5 ? ? -159.13 -49.57 103 18 THR A 8 ? ? -54.39 -77.46 104 18 SER A 9 ? ? -105.03 -156.31 105 18 CYS B 19 ? ? -119.56 -84.25 106 18 PRO B 28 ? ? -62.52 -169.97 107 19 SER A 9 ? ? -115.64 -142.65 108 19 ASN B 3 ? ? -102.26 72.64 109 19 CYS B 19 ? ? -89.80 -76.36 110 19 PHE B 25 ? ? -103.49 70.71 111 19 PRO B 28 ? ? -59.52 -170.57 112 20 CYS A 11 ? ? -80.41 -146.37 113 20 PRO B 28 ? ? -57.08 96.29 # _pdbx_nmr_ensemble.entry_id 1HLS _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version 3.0 _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLU N N N N 92 GLU CA C N S 93 GLU C C N N 94 GLU O O N N 95 GLU CB C N N 96 GLU CG C N N 97 GLU CD C N N 98 GLU OE1 O N N 99 GLU OE2 O N N 100 GLU OXT O N N 101 GLU H H N N 102 GLU H2 H N N 103 GLU HA H N N 104 GLU HB2 H N N 105 GLU HB3 H N N 106 GLU HG2 H N N 107 GLU HG3 H N N 108 GLU HE2 H N N 109 GLU HXT H N N 110 GLY N N N N 111 GLY CA C N N 112 GLY C C N N 113 GLY O O N N 114 GLY OXT O N N 115 GLY H H N N 116 GLY H2 H N N 117 GLY HA2 H N N 118 GLY HA3 H N N 119 GLY HXT H N N 120 HIS N N N N 121 HIS CA C N S 122 HIS C C N N 123 HIS O O N N 124 HIS CB C N N 125 HIS CG C Y N 126 HIS ND1 N Y N 127 HIS CD2 C Y N 128 HIS CE1 C Y N 129 HIS NE2 N Y N 130 HIS OXT O N N 131 HIS H H N N 132 HIS H2 H N N 133 HIS HA H N N 134 HIS HB2 H N N 135 HIS HB3 H N N 136 HIS HD1 H N N 137 HIS HD2 H N N 138 HIS HE1 H N N 139 HIS HE2 H N N 140 HIS HXT H N N 141 ILE N N N N 142 ILE CA C N S 143 ILE C C N N 144 ILE O O N N 145 ILE CB C N S 146 ILE CG1 C N N 147 ILE CG2 C N N 148 ILE CD1 C N N 149 ILE OXT O N N 150 ILE H H N N 151 ILE H2 H N N 152 ILE HA H N N 153 ILE HB H N N 154 ILE HG12 H N N 155 ILE HG13 H N N 156 ILE HG21 H N N 157 ILE HG22 H N N 158 ILE HG23 H N N 159 ILE HD11 H N N 160 ILE HD12 H N N 161 ILE HD13 H N N 162 ILE HXT H N N 163 LEU N N N N 164 LEU CA C N S 165 LEU C C N N 166 LEU O O N N 167 LEU CB C N N 168 LEU CG C N N 169 LEU CD1 C N N 170 LEU CD2 C N N 171 LEU OXT O N N 172 LEU H H N N 173 LEU H2 H N N 174 LEU HA H N N 175 LEU HB2 H N N 176 LEU HB3 H N N 177 LEU HG H N N 178 LEU HD11 H N N 179 LEU HD12 H N N 180 LEU HD13 H N N 181 LEU HD21 H N N 182 LEU HD22 H N N 183 LEU HD23 H N N 184 LEU HXT H N N 185 LYS N N N N 186 LYS CA C N S 187 LYS C C N N 188 LYS O O N N 189 LYS CB C N N 190 LYS CG C N N 191 LYS CD C N N 192 LYS CE C N N 193 LYS NZ N N N 194 LYS OXT O N N 195 LYS H H N N 196 LYS H2 H N N 197 LYS HA H N N 198 LYS HB2 H N N 199 LYS HB3 H N N 200 LYS HG2 H N N 201 LYS HG3 H N N 202 LYS HD2 H N N 203 LYS HD3 H N N 204 LYS HE2 H N N 205 LYS HE3 H N N 206 LYS HZ1 H N N 207 LYS HZ2 H N N 208 LYS HZ3 H N N 209 LYS HXT H N N 210 PHE N N N N 211 PHE CA C N S 212 PHE C C N N 213 PHE O O N N 214 PHE CB C N N 215 PHE CG C Y N 216 PHE CD1 C Y N 217 PHE CD2 C Y N 218 PHE CE1 C Y N 219 PHE CE2 C Y N 220 PHE CZ C Y N 221 PHE OXT O N N 222 PHE H H N N 223 PHE H2 H N N 224 PHE HA H N N 225 PHE HB2 H N N 226 PHE HB3 H N N 227 PHE HD1 H N N 228 PHE HD2 H N N 229 PHE HE1 H N N 230 PHE HE2 H N N 231 PHE HZ H N N 232 PHE HXT H N N 233 PRO N N N N 234 PRO CA C N S 235 PRO C C N N 236 PRO O O N N 237 PRO CB C N N 238 PRO CG C N N 239 PRO CD C N N 240 PRO OXT O N N 241 PRO H H N N 242 PRO HA H N N 243 PRO HB2 H N N 244 PRO HB3 H N N 245 PRO HG2 H N N 246 PRO HG3 H N N 247 PRO HD2 H N N 248 PRO HD3 H N N 249 PRO HXT H N N 250 SER N N N N 251 SER CA C N S 252 SER C C N N 253 SER O O N N 254 SER CB C N N 255 SER OG O N N 256 SER OXT O N N 257 SER H H N N 258 SER H2 H N N 259 SER HA H N N 260 SER HB2 H N N 261 SER HB3 H N N 262 SER HG H N N 263 SER HXT H N N 264 THR N N N N 265 THR CA C N S 266 THR C C N N 267 THR O O N N 268 THR CB C N R 269 THR OG1 O N N 270 THR CG2 C N N 271 THR OXT O N N 272 THR H H N N 273 THR H2 H N N 274 THR HA H N N 275 THR HB H N N 276 THR HG1 H N N 277 THR HG21 H N N 278 THR HG22 H N N 279 THR HG23 H N N 280 THR HXT H N N 281 TYR N N N N 282 TYR CA C N S 283 TYR C C N N 284 TYR O O N N 285 TYR CB C N N 286 TYR CG C Y N 287 TYR CD1 C Y N 288 TYR CD2 C Y N 289 TYR CE1 C Y N 290 TYR CE2 C Y N 291 TYR CZ C Y N 292 TYR OH O N N 293 TYR OXT O N N 294 TYR H H N N 295 TYR H2 H N N 296 TYR HA H N N 297 TYR HB2 H N N 298 TYR HB3 H N N 299 TYR HD1 H N N 300 TYR HD2 H N N 301 TYR HE1 H N N 302 TYR HE2 H N N 303 TYR HH H N N 304 TYR HXT H N N 305 VAL N N N N 306 VAL CA C N S 307 VAL C C N N 308 VAL O O N N 309 VAL CB C N N 310 VAL CG1 C N N 311 VAL CG2 C N N 312 VAL OXT O N N 313 VAL H H N N 314 VAL H2 H N N 315 VAL HA H N N 316 VAL HB H N N 317 VAL HG11 H N N 318 VAL HG12 H N N 319 VAL HG13 H N N 320 VAL HG21 H N N 321 VAL HG22 H N N 322 VAL HG23 H N N 323 VAL HXT H N N 324 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLN N CA sing N N 68 GLN N H sing N N 69 GLN N H2 sing N N 70 GLN CA C sing N N 71 GLN CA CB sing N N 72 GLN CA HA sing N N 73 GLN C O doub N N 74 GLN C OXT sing N N 75 GLN CB CG sing N N 76 GLN CB HB2 sing N N 77 GLN CB HB3 sing N N 78 GLN CG CD sing N N 79 GLN CG HG2 sing N N 80 GLN CG HG3 sing N N 81 GLN CD OE1 doub N N 82 GLN CD NE2 sing N N 83 GLN NE2 HE21 sing N N 84 GLN NE2 HE22 sing N N 85 GLN OXT HXT sing N N 86 GLU N CA sing N N 87 GLU N H sing N N 88 GLU N H2 sing N N 89 GLU CA C sing N N 90 GLU CA CB sing N N 91 GLU CA HA sing N N 92 GLU C O doub N N 93 GLU C OXT sing N N 94 GLU CB CG sing N N 95 GLU CB HB2 sing N N 96 GLU CB HB3 sing N N 97 GLU CG CD sing N N 98 GLU CG HG2 sing N N 99 GLU CG HG3 sing N N 100 GLU CD OE1 doub N N 101 GLU CD OE2 sing N N 102 GLU OE2 HE2 sing N N 103 GLU OXT HXT sing N N 104 GLY N CA sing N N 105 GLY N H sing N N 106 GLY N H2 sing N N 107 GLY CA C sing N N 108 GLY CA HA2 sing N N 109 GLY CA HA3 sing N N 110 GLY C O doub N N 111 GLY C OXT sing N N 112 GLY OXT HXT sing N N 113 HIS N CA sing N N 114 HIS N H sing N N 115 HIS N H2 sing N N 116 HIS CA C sing N N 117 HIS CA CB sing N N 118 HIS CA HA sing N N 119 HIS C O doub N N 120 HIS C OXT sing N N 121 HIS CB CG sing N N 122 HIS CB HB2 sing N N 123 HIS CB HB3 sing N N 124 HIS CG ND1 sing Y N 125 HIS CG CD2 doub Y N 126 HIS ND1 CE1 doub Y N 127 HIS ND1 HD1 sing N N 128 HIS CD2 NE2 sing Y N 129 HIS CD2 HD2 sing N N 130 HIS CE1 NE2 sing Y N 131 HIS CE1 HE1 sing N N 132 HIS NE2 HE2 sing N N 133 HIS OXT HXT sing N N 134 ILE N CA sing N N 135 ILE N H sing N N 136 ILE N H2 sing N N 137 ILE CA C sing N N 138 ILE CA CB sing N N 139 ILE CA HA sing N N 140 ILE C O doub N N 141 ILE C OXT sing N N 142 ILE CB CG1 sing N N 143 ILE CB CG2 sing N N 144 ILE CB HB sing N N 145 ILE CG1 CD1 sing N N 146 ILE CG1 HG12 sing N N 147 ILE CG1 HG13 sing N N 148 ILE CG2 HG21 sing N N 149 ILE CG2 HG22 sing N N 150 ILE CG2 HG23 sing N N 151 ILE CD1 HD11 sing N N 152 ILE CD1 HD12 sing N N 153 ILE CD1 HD13 sing N N 154 ILE OXT HXT sing N N 155 LEU N CA sing N N 156 LEU N H sing N N 157 LEU N H2 sing N N 158 LEU CA C sing N N 159 LEU CA CB sing N N 160 LEU CA HA sing N N 161 LEU C O doub N N 162 LEU C OXT sing N N 163 LEU CB CG sing N N 164 LEU CB HB2 sing N N 165 LEU CB HB3 sing N N 166 LEU CG CD1 sing N N 167 LEU CG CD2 sing N N 168 LEU CG HG sing N N 169 LEU CD1 HD11 sing N N 170 LEU CD1 HD12 sing N N 171 LEU CD1 HD13 sing N N 172 LEU CD2 HD21 sing N N 173 LEU CD2 HD22 sing N N 174 LEU CD2 HD23 sing N N 175 LEU OXT HXT sing N N 176 LYS N CA sing N N 177 LYS N H sing N N 178 LYS N H2 sing N N 179 LYS CA C sing N N 180 LYS CA CB sing N N 181 LYS CA HA sing N N 182 LYS C O doub N N 183 LYS C OXT sing N N 184 LYS CB CG sing N N 185 LYS CB HB2 sing N N 186 LYS CB HB3 sing N N 187 LYS CG CD sing N N 188 LYS CG HG2 sing N N 189 LYS CG HG3 sing N N 190 LYS CD CE sing N N 191 LYS CD HD2 sing N N 192 LYS CD HD3 sing N N 193 LYS CE NZ sing N N 194 LYS CE HE2 sing N N 195 LYS CE HE3 sing N N 196 LYS NZ HZ1 sing N N 197 LYS NZ HZ2 sing N N 198 LYS NZ HZ3 sing N N 199 LYS OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 THR N CA sing N N 254 THR N H sing N N 255 THR N H2 sing N N 256 THR CA C sing N N 257 THR CA CB sing N N 258 THR CA HA sing N N 259 THR C O doub N N 260 THR C OXT sing N N 261 THR CB OG1 sing N N 262 THR CB CG2 sing N N 263 THR CB HB sing N N 264 THR OG1 HG1 sing N N 265 THR CG2 HG21 sing N N 266 THR CG2 HG22 sing N N 267 THR CG2 HG23 sing N N 268 THR OXT HXT sing N N 269 TYR N CA sing N N 270 TYR N H sing N N 271 TYR N H2 sing N N 272 TYR CA C sing N N 273 TYR CA CB sing N N 274 TYR CA HA sing N N 275 TYR C O doub N N 276 TYR C OXT sing N N 277 TYR CB CG sing N N 278 TYR CB HB2 sing N N 279 TYR CB HB3 sing N N 280 TYR CG CD1 doub Y N 281 TYR CG CD2 sing Y N 282 TYR CD1 CE1 sing Y N 283 TYR CD1 HD1 sing N N 284 TYR CD2 CE2 doub Y N 285 TYR CD2 HD2 sing N N 286 TYR CE1 CZ doub Y N 287 TYR CE1 HE1 sing N N 288 TYR CE2 CZ sing Y N 289 TYR CE2 HE2 sing N N 290 TYR CZ OH sing N N 291 TYR OH HH sing N N 292 TYR OXT HXT sing N N 293 VAL N CA sing N N 294 VAL N H sing N N 295 VAL N H2 sing N N 296 VAL CA C sing N N 297 VAL CA CB sing N N 298 VAL CA HA sing N N 299 VAL C O doub N N 300 VAL C OXT sing N N 301 VAL CB CG1 sing N N 302 VAL CB CG2 sing N N 303 VAL CB HB sing N N 304 VAL CG1 HG11 sing N N 305 VAL CG1 HG12 sing N N 306 VAL CG1 HG13 sing N N 307 VAL CG2 HG21 sing N N 308 VAL CG2 HG22 sing N N 309 VAL CG2 HG23 sing N N 310 VAL OXT HXT sing N N 311 # _atom_sites.entry_id 1HLS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_