data_1HP7 # _entry.id 1HP7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1HP7 pdb_00001hp7 10.2210/pdb1hp7/pdb RCSB RCSB012498 ? ? WWPDB D_1000012498 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HP7 _pdbx_database_status.recvd_initial_deposition_date 2000-12-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kim, S.-J.' 1 'Woo, J.-R.' 2 'Seo, E.J.' 3 'Yu, M.-H.' 4 'Ryu, S.-E.' 5 # _citation.id primary _citation.title 'A 2.1 A resolution structure of an uncleaved alpha(1)-antitrypsin shows variability of the reactive center and other loops.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 306 _citation.page_first 109 _citation.page_last 119 _citation.year 2001 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11178897 _citation.pdbx_database_id_DOI 10.1006/jmbi.2000.4357 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, S.' 1 ? primary 'Woo, J.' 2 ? primary 'Seo, E.J.' 3 ? primary 'Yu, M.' 4 ? primary 'Ryu, S.' 5 ? # _cell.entry_id 1HP7 _cell.length_a 77.57 _cell.length_b 77.57 _cell.length_c 124.29 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1HP7 _symmetry.space_group_name_H-M 'P 32 1 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 153 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ALPHA-1-ANTITRYPSIN 44331.258 1 ? A70G ? ? 2 non-polymer syn 'ZINC ION' 65.409 5 ? ? ? ? 3 non-polymer syn BETA-MERCAPTOETHANOL 78.133 1 ? ? ? ? 4 water nat water 18.015 95 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKGDTHDEILEGL NFNLTEIPEAQIHEGFQELLHTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDY VEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVL LMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSG VTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK ; _entity_poly.pdbx_seq_one_letter_code_can ;EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKGDTHDEILEGL NFNLTEIPEAQIHEGFQELLHTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDY VEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVL LMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSG VTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ASP n 1 3 PRO n 1 4 GLN n 1 5 GLY n 1 6 ASP n 1 7 ALA n 1 8 ALA n 1 9 GLN n 1 10 LYS n 1 11 THR n 1 12 ASP n 1 13 THR n 1 14 SER n 1 15 HIS n 1 16 HIS n 1 17 ASP n 1 18 GLN n 1 19 ASP n 1 20 HIS n 1 21 PRO n 1 22 THR n 1 23 PHE n 1 24 ASN n 1 25 LYS n 1 26 ILE n 1 27 THR n 1 28 PRO n 1 29 ASN n 1 30 LEU n 1 31 ALA n 1 32 GLU n 1 33 PHE n 1 34 ALA n 1 35 PHE n 1 36 SER n 1 37 LEU n 1 38 TYR n 1 39 ARG n 1 40 GLN n 1 41 LEU n 1 42 ALA n 1 43 HIS n 1 44 GLN n 1 45 SER n 1 46 ASN n 1 47 SER n 1 48 THR n 1 49 ASN n 1 50 ILE n 1 51 PHE n 1 52 PHE n 1 53 SER n 1 54 PRO n 1 55 VAL n 1 56 SER n 1 57 ILE n 1 58 ALA n 1 59 THR n 1 60 ALA n 1 61 PHE n 1 62 ALA n 1 63 MET n 1 64 LEU n 1 65 SER n 1 66 LEU n 1 67 GLY n 1 68 THR n 1 69 LYS n 1 70 GLY n 1 71 ASP n 1 72 THR n 1 73 HIS n 1 74 ASP n 1 75 GLU n 1 76 ILE n 1 77 LEU n 1 78 GLU n 1 79 GLY n 1 80 LEU n 1 81 ASN n 1 82 PHE n 1 83 ASN n 1 84 LEU n 1 85 THR n 1 86 GLU n 1 87 ILE n 1 88 PRO n 1 89 GLU n 1 90 ALA n 1 91 GLN n 1 92 ILE n 1 93 HIS n 1 94 GLU n 1 95 GLY n 1 96 PHE n 1 97 GLN n 1 98 GLU n 1 99 LEU n 1 100 LEU n 1 101 HIS n 1 102 THR n 1 103 LEU n 1 104 ASN n 1 105 GLN n 1 106 PRO n 1 107 ASP n 1 108 SER n 1 109 GLN n 1 110 LEU n 1 111 GLN n 1 112 LEU n 1 113 THR n 1 114 THR n 1 115 GLY n 1 116 ASN n 1 117 GLY n 1 118 LEU n 1 119 PHE n 1 120 LEU n 1 121 SER n 1 122 GLU n 1 123 GLY n 1 124 LEU n 1 125 LYS n 1 126 LEU n 1 127 VAL n 1 128 ASP n 1 129 LYS n 1 130 PHE n 1 131 LEU n 1 132 GLU n 1 133 ASP n 1 134 VAL n 1 135 LYS n 1 136 LYS n 1 137 LEU n 1 138 TYR n 1 139 HIS n 1 140 SER n 1 141 GLU n 1 142 ALA n 1 143 PHE n 1 144 THR n 1 145 VAL n 1 146 ASN n 1 147 PHE n 1 148 GLY n 1 149 ASP n 1 150 THR n 1 151 GLU n 1 152 GLU n 1 153 ALA n 1 154 LYS n 1 155 LYS n 1 156 GLN n 1 157 ILE n 1 158 ASN n 1 159 ASP n 1 160 TYR n 1 161 VAL n 1 162 GLU n 1 163 LYS n 1 164 GLY n 1 165 THR n 1 166 GLN n 1 167 GLY n 1 168 LYS n 1 169 ILE n 1 170 VAL n 1 171 ASP n 1 172 LEU n 1 173 VAL n 1 174 LYS n 1 175 GLU n 1 176 LEU n 1 177 ASP n 1 178 ARG n 1 179 ASP n 1 180 THR n 1 181 VAL n 1 182 PHE n 1 183 ALA n 1 184 LEU n 1 185 VAL n 1 186 ASN n 1 187 TYR n 1 188 ILE n 1 189 PHE n 1 190 PHE n 1 191 LYS n 1 192 GLY n 1 193 LYS n 1 194 TRP n 1 195 GLU n 1 196 ARG n 1 197 PRO n 1 198 PHE n 1 199 GLU n 1 200 VAL n 1 201 LYS n 1 202 ASP n 1 203 THR n 1 204 GLU n 1 205 GLU n 1 206 GLU n 1 207 ASP n 1 208 PHE n 1 209 HIS n 1 210 VAL n 1 211 ASP n 1 212 GLN n 1 213 VAL n 1 214 THR n 1 215 THR n 1 216 VAL n 1 217 LYS n 1 218 VAL n 1 219 PRO n 1 220 MET n 1 221 MET n 1 222 LYS n 1 223 ARG n 1 224 LEU n 1 225 GLY n 1 226 MET n 1 227 PHE n 1 228 ASN n 1 229 ILE n 1 230 GLN n 1 231 HIS n 1 232 CYS n 1 233 LYS n 1 234 LYS n 1 235 LEU n 1 236 SER n 1 237 SER n 1 238 TRP n 1 239 VAL n 1 240 LEU n 1 241 LEU n 1 242 MET n 1 243 LYS n 1 244 TYR n 1 245 LEU n 1 246 GLY n 1 247 ASN n 1 248 ALA n 1 249 THR n 1 250 ALA n 1 251 ILE n 1 252 PHE n 1 253 PHE n 1 254 LEU n 1 255 PRO n 1 256 ASP n 1 257 GLU n 1 258 GLY n 1 259 LYS n 1 260 LEU n 1 261 GLN n 1 262 HIS n 1 263 LEU n 1 264 GLU n 1 265 ASN n 1 266 GLU n 1 267 LEU n 1 268 THR n 1 269 HIS n 1 270 ASP n 1 271 ILE n 1 272 ILE n 1 273 THR n 1 274 LYS n 1 275 PHE n 1 276 LEU n 1 277 GLU n 1 278 ASN n 1 279 GLU n 1 280 ASP n 1 281 ARG n 1 282 ARG n 1 283 SER n 1 284 ALA n 1 285 SER n 1 286 LEU n 1 287 HIS n 1 288 LEU n 1 289 PRO n 1 290 LYS n 1 291 LEU n 1 292 SER n 1 293 ILE n 1 294 THR n 1 295 GLY n 1 296 THR n 1 297 TYR n 1 298 ASP n 1 299 LEU n 1 300 LYS n 1 301 SER n 1 302 VAL n 1 303 LEU n 1 304 GLY n 1 305 GLN n 1 306 LEU n 1 307 GLY n 1 308 ILE n 1 309 THR n 1 310 LYS n 1 311 VAL n 1 312 PHE n 1 313 SER n 1 314 ASN n 1 315 GLY n 1 316 ALA n 1 317 ASP n 1 318 LEU n 1 319 SER n 1 320 GLY n 1 321 VAL n 1 322 THR n 1 323 GLU n 1 324 GLU n 1 325 ALA n 1 326 PRO n 1 327 LEU n 1 328 LYS n 1 329 LEU n 1 330 SER n 1 331 LYS n 1 332 ALA n 1 333 VAL n 1 334 HIS n 1 335 LYS n 1 336 ALA n 1 337 VAL n 1 338 LEU n 1 339 THR n 1 340 ILE n 1 341 ASP n 1 342 GLU n 1 343 LYS n 1 344 GLY n 1 345 THR n 1 346 GLU n 1 347 ALA n 1 348 ALA n 1 349 GLY n 1 350 ALA n 1 351 MET n 1 352 PHE n 1 353 LEU n 1 354 GLU n 1 355 ALA n 1 356 ILE n 1 357 PRO n 1 358 MET n 1 359 SER n 1 360 ILE n 1 361 PRO n 1 362 PRO n 1 363 GLU n 1 364 VAL n 1 365 LYS n 1 366 PHE n 1 367 ASN n 1 368 LYS n 1 369 PRO n 1 370 PHE n 1 371 VAL n 1 372 PHE n 1 373 LEU n 1 374 MET n 1 375 ILE n 1 376 ASP n 1 377 GLN n 1 378 ASN n 1 379 THR n 1 380 LYS n 1 381 SER n 1 382 PRO n 1 383 LEU n 1 384 PHE n 1 385 MET n 1 386 GLY n 1 387 LYS n 1 388 VAL n 1 389 VAL n 1 390 ASN n 1 391 PRO n 1 392 THR n 1 393 GLN n 1 394 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PEAT8 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A1AT_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P01009 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1HP7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 394 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01009 _struct_ref_seq.db_align_beg 25 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 418 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 394 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1HP7 GLY A 70 ? UNP P01009 ALA 94 'engineered mutation' 70 1 1 1HP7 HIS A 101 ? UNP P01009 ARG 125 'SEE REMARK 999' 101 2 1 1HP7 ASP A 376 ? UNP P01009 GLU 400 'SEE REMARK 999' 376 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BME non-polymer . BETA-MERCAPTOETHANOL ? 'C2 H6 O S' 78.133 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 1HP7 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.43 _exptl_crystal.density_percent_sol 49.47 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine.entry_id 1HP7 _refine.ls_number_reflns_obs 23044 _refine.ls_number_reflns_all 25323 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 99 _refine.ls_d_res_high 2.1 _refine.ls_percent_reflns_obs 91 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2190000 _refine.ls_R_factor_R_free 0.2730000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 1152 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MIR _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2985 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.number_atoms_solvent 95 _refine_hist.number_atoms_total 3089 _refine_hist.d_res_high 2.1 _refine_hist.d_res_low 99 # _struct.entry_id 1HP7 _struct.title 'A 2.1 ANGSTROM STRUCTURE OF AN UNCLEAVED ALPHA-1-ANTITRYPSIN SHOWS VARIABILITY OF THE REACTIVE CENTER AND OTHER LOOPS' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1HP7 _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'uncleaved alpha-1-antitrypsin serpin, PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 3 ? H N N 4 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 26 ? SER A 45 ? ILE A 26 SER A 45 1 ? 20 HELX_P HELX_P2 2 SER A 53 ? LEU A 66 ? SER A 53 LEU A 66 1 ? 14 HELX_P HELX_P3 3 LYS A 69 ? LEU A 80 ? LYS A 69 LEU A 80 1 ? 12 HELX_P HELX_P4 4 PRO A 88 ? ASN A 104 ? PRO A 88 ASN A 104 1 ? 17 HELX_P HELX_P5 5 VAL A 127 ? LEU A 137 ? VAL A 127 LEU A 137 1 ? 11 HELX_P HELX_P6 6 ASP A 149 ? THR A 165 ? ASP A 149 THR A 165 1 ? 17 HELX_P HELX_P7 7 GLU A 199 ? THR A 203 ? GLU A 199 THR A 203 5 ? 5 HELX_P HELX_P8 8 LYS A 259 ? LEU A 267 ? LYS A 259 LEU A 267 1 ? 9 HELX_P HELX_P9 9 THR A 268 ? LEU A 276 ? THR A 268 LEU A 276 1 ? 9 HELX_P HELX_P10 10 LEU A 299 ? LEU A 306 ? LEU A 299 LEU A 306 1 ? 8 HELX_P HELX_P11 11 THR A 309 ? SER A 313 ? THR A 309 SER A 313 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 232 SG ? ? ? 1_555 G BME . S2 ? ? A CYS 232 A BME 432 1_555 ? ? ? ? ? ? ? 2.030 ? ? metalc1 metalc ? ? A HIS 43 NE2 ? ? ? 4_665 D ZN . ZN ? ? A HIS 43 A ZN 403 1_555 ? ? ? ? ? ? ? 2.008 ? ? metalc2 metalc ? ? A HIS 73 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 73 A ZN 401 1_555 ? ? ? ? ? ? ? 2.077 ? ? metalc3 metalc ? ? A GLU 89 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 89 A ZN 401 1_555 ? ? ? ? ? ? ? 2.047 ? ? metalc4 metalc ? ? A HIS 93 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 93 A ZN 401 1_555 ? ? ? ? ? ? ? 2.117 ? ? metalc5 metalc ? ? A GLU 98 OE2 ? ? ? 5_555 F ZN . ZN ? ? A GLU 98 A ZN 405 1_555 ? ? ? ? ? ? ? 2.124 ? ? metalc6 metalc ? ? A GLU 98 OE1 ? ? ? 5_555 F ZN . ZN ? ? A GLU 98 A ZN 405 1_555 ? ? ? ? ? ? ? 2.770 ? ? metalc7 metalc ? ? A HIS 101 NE2 ? ? ? 1_555 F ZN . ZN ? ? A HIS 101 A ZN 405 1_555 ? ? ? ? ? ? ? 1.856 ? ? metalc8 metalc ? ? A HIS 139 NE2 ? ? ? 1_555 F ZN . ZN ? ? A HIS 139 A ZN 405 1_555 ? ? ? ? ? ? ? 2.083 ? ? metalc9 metalc ? ? A GLU 151 OE2 ? ? ? 1_555 C ZN . ZN ? ? A GLU 151 A ZN 402 1_555 ? ? ? ? ? ? ? 1.890 ? ? metalc10 metalc ? ? A GLU 175 OE2 ? ? ? 1_555 C ZN . ZN ? ? A GLU 175 A ZN 402 1_555 ? ? ? ? ? ? ? 2.190 ? ? metalc11 metalc ? ? A GLU 175 OE1 ? ? ? 1_555 C ZN . ZN ? ? A GLU 175 A ZN 402 1_555 ? ? ? ? ? ? ? 2.561 ? ? metalc12 metalc ? ? A HIS 231 NE2 ? ? ? 3_665 C ZN . ZN ? ? A HIS 231 A ZN 402 1_555 ? ? ? ? ? ? ? 1.857 ? ? metalc13 metalc ? ? A ASP 256 OD1 ? ? ? 3_665 C ZN . ZN ? ? A ASP 256 A ZN 402 1_555 ? ? ? ? ? ? ? 1.995 ? ? metalc14 metalc ? ? A HIS 262 ND1 ? ? ? 1_555 D ZN . ZN ? ? A HIS 262 A ZN 403 1_555 ? ? ? ? ? ? ? 2.083 ? ? metalc15 metalc ? ? A SER 285 OG ? ? ? 1_555 E ZN . ZN ? ? A SER 285 A ZN 404 1_555 ? ? ? ? ? ? ? 1.982 ? ? metalc16 metalc ? ? A HIS 287 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 287 A ZN 404 1_555 ? ? ? ? ? ? ? 2.463 ? ? metalc17 metalc ? ? A GLU 324 OE1 ? ? ? 5_545 E ZN . ZN ? ? A GLU 324 A ZN 404 1_555 ? ? ? ? ? ? ? 2.272 ? ? metalc18 metalc ? ? A GLU 363 OE1 ? ? ? 1_555 E ZN . ZN ? ? A GLU 363 A ZN 404 1_555 ? ? ? ? ? ? ? 2.174 ? ? metalc19 metalc ? ? B ZN . ZN ? ? ? 1_555 H HOH . O ? ? A ZN 401 A HOH 486 1_555 ? ? ? ? ? ? ? 2.039 ? ? metalc20 metalc ? ? D ZN . ZN ? ? ? 1_555 H HOH . O ? ? A ZN 403 A HOH 438 1_555 ? ? ? ? ? ? ? 2.273 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 8 ? C ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel B 7 8 ? anti-parallel C 1 2 ? parallel C 2 3 ? anti-parallel C 3 4 ? parallel C 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 363 ? LYS A 365 ? GLU A 363 LYS A 365 A 2 ARG A 282 ? PRO A 289 ? ARG A 282 PRO A 289 A 3 THR A 215 ? CYS A 232 ? THR A 215 CYS A 232 A 4 GLU A 204 ? HIS A 209 ? GLU A 204 HIS A 209 B 1 GLU A 363 ? LYS A 365 ? GLU A 363 LYS A 365 B 2 ARG A 282 ? PRO A 289 ? ARG A 282 PRO A 289 B 3 THR A 215 ? CYS A 232 ? THR A 215 CYS A 232 B 4 SER A 237 ? TYR A 244 ? SER A 237 TYR A 244 B 5 ALA A 248 ? PRO A 255 ? ALA A 248 PRO A 255 B 6 PHE A 370 ? ASP A 376 ? PHE A 370 ASP A 376 B 7 PRO A 382 ? VAL A 388 ? PRO A 382 VAL A 388 B 8 ILE A 50 ? PHE A 52 ? ILE A 50 PHE A 52 C 1 GLU A 141 ? VAL A 145 ? GLU A 141 VAL A 145 C 2 GLN A 111 ? SER A 121 ? GLN A 111 SER A 121 C 3 PHE A 182 ? LYS A 191 ? PHE A 182 LYS A 191 C 4 LYS A 331 ? ILE A 340 ? LYS A 331 ILE A 340 C 5 LEU A 291 ? ASP A 298 ? LEU A 291 ASP A 298 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 364 ? N VAL A 364 O SER A 285 ? O SER A 285 A 2 3 O LEU A 288 ? O LEU A 288 N MET A 221 ? N MET A 221 A 3 4 N MET A 220 ? N MET A 220 O GLU A 204 ? O GLU A 204 B 1 2 N VAL A 364 ? N VAL A 364 O SER A 285 ? O SER A 285 B 2 3 O LEU A 288 ? O LEU A 288 N MET A 221 ? N MET A 221 B 3 4 N CYS A 232 ? N CYS A 232 O SER A 237 ? O SER A 237 B 4 5 N TYR A 244 ? N TYR A 244 O ALA A 248 ? O ALA A 248 B 5 6 N PHE A 253 ? N PHE A 253 O VAL A 371 ? O VAL A 371 B 6 7 O MET A 374 ? O MET A 374 N LEU A 383 ? N LEU A 383 B 7 8 N LYS A 387 ? N LYS A 387 O ILE A 50 ? O ILE A 50 C 1 2 N GLU A 141 ? N GLU A 141 O ASN A 116 ? O ASN A 116 C 2 3 O PHE A 119 ? O PHE A 119 N ALA A 183 ? N ALA A 183 C 3 4 N LEU A 184 ? N LEU A 184 O LYS A 331 ? O LYS A 331 C 4 5 N ILE A 340 ? N ILE A 340 O LEU A 291 ? O LEU A 291 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' AC2 Software A ZN 402 ? 4 'BINDING SITE FOR RESIDUE ZN A 402' AC3 Software A ZN 403 ? 3 'BINDING SITE FOR RESIDUE ZN A 403' AC4 Software A ZN 404 ? 4 'BINDING SITE FOR RESIDUE ZN A 404' AC5 Software A ZN 405 ? 3 'BINDING SITE FOR RESIDUE ZN A 405' AC6 Software A BME 432 ? 2 'BINDING SITE FOR RESIDUE BME A 432' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 73 ? HIS A 73 . ? 1_555 ? 2 AC1 4 GLU A 89 ? GLU A 89 . ? 1_555 ? 3 AC1 4 HIS A 93 ? HIS A 93 . ? 1_555 ? 4 AC1 4 HOH H . ? HOH A 486 . ? 1_555 ? 5 AC2 4 GLU A 151 ? GLU A 151 . ? 1_555 ? 6 AC2 4 GLU A 175 ? GLU A 175 . ? 1_555 ? 7 AC2 4 HIS A 231 ? HIS A 231 . ? 3_665 ? 8 AC2 4 ASP A 256 ? ASP A 256 . ? 3_665 ? 9 AC3 3 HIS A 43 ? HIS A 43 . ? 4_665 ? 10 AC3 3 HIS A 262 ? HIS A 262 . ? 1_555 ? 11 AC3 3 HOH H . ? HOH A 438 . ? 1_555 ? 12 AC4 4 SER A 285 ? SER A 285 . ? 1_555 ? 13 AC4 4 HIS A 287 ? HIS A 287 . ? 1_555 ? 14 AC4 4 GLU A 324 ? GLU A 324 . ? 5_545 ? 15 AC4 4 GLU A 363 ? GLU A 363 . ? 1_555 ? 16 AC5 3 GLU A 98 ? GLU A 98 . ? 5_555 ? 17 AC5 3 HIS A 101 ? HIS A 101 . ? 1_555 ? 18 AC5 3 HIS A 139 ? HIS A 139 . ? 1_555 ? 19 AC6 2 CYS A 232 ? CYS A 232 . ? 1_555 ? 20 AC6 2 LYS A 233 ? LYS A 233 . ? 1_555 ? # _database_PDB_matrix.entry_id 1HP7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1HP7 _atom_sites.fract_transf_matrix[1][1] 0.012892 _atom_sites.fract_transf_matrix[1][2] 0.007443 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014886 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008046 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 PRO 3 3 ? ? ? A . n A 1 4 GLN 4 4 ? ? ? A . n A 1 5 GLY 5 5 ? ? ? A . n A 1 6 ASP 6 6 ? ? ? A . n A 1 7 ALA 7 7 ? ? ? A . n A 1 8 ALA 8 8 ? ? ? A . n A 1 9 GLN 9 9 ? ? ? A . n A 1 10 LYS 10 10 ? ? ? A . n A 1 11 THR 11 11 ? ? ? A . n A 1 12 ASP 12 12 ? ? ? A . n A 1 13 THR 13 13 ? ? ? A . n A 1 14 SER 14 14 ? ? ? A . n A 1 15 HIS 15 15 ? ? ? A . n A 1 16 HIS 16 16 ? ? ? A . n A 1 17 ASP 17 17 ? ? ? A . n A 1 18 GLN 18 18 ? ? ? A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 MET 63 63 63 MET MET A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 TYR 138 138 138 TYR TYR A . n A 1 139 HIS 139 139 139 HIS HIS A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 THR 150 150 150 THR THR A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 GLN 156 156 156 GLN GLN A . n A 1 157 ILE 157 157 157 ILE ILE A . n A 1 158 ASN 158 158 158 ASN ASN A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 TYR 160 160 160 TYR TYR A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 ARG 178 178 178 ARG ARG A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 PHE 182 182 182 PHE PHE A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 ASN 186 186 186 ASN ASN A . n A 1 187 TYR 187 187 187 TYR TYR A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 PHE 189 189 189 PHE PHE A . n A 1 190 PHE 190 190 190 PHE PHE A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 LYS 193 193 193 LYS LYS A . n A 1 194 TRP 194 194 194 TRP TRP A . n A 1 195 GLU 195 195 195 GLU GLU A . n A 1 196 ARG 196 196 196 ARG ARG A . n A 1 197 PRO 197 197 197 PRO PRO A . n A 1 198 PHE 198 198 198 PHE PHE A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 LYS 201 201 201 LYS LYS A . n A 1 202 ASP 202 202 202 ASP ASP A . n A 1 203 THR 203 203 203 THR THR A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 GLU 205 205 205 GLU GLU A . n A 1 206 GLU 206 206 206 GLU GLU A . n A 1 207 ASP 207 207 207 ASP ASP A . n A 1 208 PHE 208 208 208 PHE PHE A . n A 1 209 HIS 209 209 209 HIS HIS A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 ASP 211 211 211 ASP ASP A . n A 1 212 GLN 212 212 212 GLN GLN A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 THR 214 214 214 THR THR A . n A 1 215 THR 215 215 215 THR THR A . n A 1 216 VAL 216 216 216 VAL VAL A . n A 1 217 LYS 217 217 217 LYS LYS A . n A 1 218 VAL 218 218 218 VAL VAL A . n A 1 219 PRO 219 219 219 PRO PRO A . n A 1 220 MET 220 220 220 MET MET A . n A 1 221 MET 221 221 221 MET MET A . n A 1 222 LYS 222 222 222 LYS LYS A . n A 1 223 ARG 223 223 223 ARG ARG A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 GLY 225 225 225 GLY GLY A . n A 1 226 MET 226 226 226 MET MET A . n A 1 227 PHE 227 227 227 PHE PHE A . n A 1 228 ASN 228 228 228 ASN ASN A . n A 1 229 ILE 229 229 229 ILE ILE A . n A 1 230 GLN 230 230 230 GLN GLN A . n A 1 231 HIS 231 231 231 HIS HIS A . n A 1 232 CYS 232 232 232 CYS CYS A . n A 1 233 LYS 233 233 233 LYS LYS A . n A 1 234 LYS 234 234 234 LYS LYS A . n A 1 235 LEU 235 235 235 LEU LEU A . n A 1 236 SER 236 236 236 SER SER A . n A 1 237 SER 237 237 237 SER SER A . n A 1 238 TRP 238 238 238 TRP TRP A . n A 1 239 VAL 239 239 239 VAL VAL A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 MET 242 242 242 MET MET A . n A 1 243 LYS 243 243 243 LYS LYS A . n A 1 244 TYR 244 244 244 TYR TYR A . n A 1 245 LEU 245 245 245 LEU LEU A . n A 1 246 GLY 246 246 246 GLY GLY A . n A 1 247 ASN 247 247 247 ASN ASN A . n A 1 248 ALA 248 248 248 ALA ALA A . n A 1 249 THR 249 249 249 THR THR A . n A 1 250 ALA 250 250 250 ALA ALA A . n A 1 251 ILE 251 251 251 ILE ILE A . n A 1 252 PHE 252 252 252 PHE PHE A . n A 1 253 PHE 253 253 253 PHE PHE A . n A 1 254 LEU 254 254 254 LEU LEU A . n A 1 255 PRO 255 255 255 PRO PRO A . n A 1 256 ASP 256 256 256 ASP ASP A . n A 1 257 GLU 257 257 257 GLU GLU A . n A 1 258 GLY 258 258 258 GLY GLY A . n A 1 259 LYS 259 259 259 LYS LYS A . n A 1 260 LEU 260 260 260 LEU LEU A . n A 1 261 GLN 261 261 261 GLN GLN A . n A 1 262 HIS 262 262 262 HIS HIS A . n A 1 263 LEU 263 263 263 LEU LEU A . n A 1 264 GLU 264 264 264 GLU GLU A . n A 1 265 ASN 265 265 265 ASN ASN A . n A 1 266 GLU 266 266 266 GLU GLU A . n A 1 267 LEU 267 267 267 LEU LEU A . n A 1 268 THR 268 268 268 THR THR A . n A 1 269 HIS 269 269 269 HIS HIS A . n A 1 270 ASP 270 270 270 ASP ASP A . n A 1 271 ILE 271 271 271 ILE ILE A . n A 1 272 ILE 272 272 272 ILE ILE A . n A 1 273 THR 273 273 273 THR THR A . n A 1 274 LYS 274 274 274 LYS LYS A . n A 1 275 PHE 275 275 275 PHE PHE A . n A 1 276 LEU 276 276 276 LEU LEU A . n A 1 277 GLU 277 277 277 GLU GLU A . n A 1 278 ASN 278 278 278 ASN ASN A . n A 1 279 GLU 279 279 279 GLU GLU A . n A 1 280 ASP 280 280 280 ASP ASP A . n A 1 281 ARG 281 281 281 ARG ARG A . n A 1 282 ARG 282 282 282 ARG ARG A . n A 1 283 SER 283 283 283 SER SER A . n A 1 284 ALA 284 284 284 ALA ALA A . n A 1 285 SER 285 285 285 SER SER A . n A 1 286 LEU 286 286 286 LEU LEU A . n A 1 287 HIS 287 287 287 HIS HIS A . n A 1 288 LEU 288 288 288 LEU LEU A . n A 1 289 PRO 289 289 289 PRO PRO A . n A 1 290 LYS 290 290 290 LYS LYS A . n A 1 291 LEU 291 291 291 LEU LEU A . n A 1 292 SER 292 292 292 SER SER A . n A 1 293 ILE 293 293 293 ILE ILE A . n A 1 294 THR 294 294 294 THR THR A . n A 1 295 GLY 295 295 295 GLY GLY A . n A 1 296 THR 296 296 296 THR THR A . n A 1 297 TYR 297 297 297 TYR TYR A . n A 1 298 ASP 298 298 298 ASP ASP A . n A 1 299 LEU 299 299 299 LEU LEU A . n A 1 300 LYS 300 300 300 LYS LYS A . n A 1 301 SER 301 301 301 SER SER A . n A 1 302 VAL 302 302 302 VAL VAL A . n A 1 303 LEU 303 303 303 LEU LEU A . n A 1 304 GLY 304 304 304 GLY GLY A . n A 1 305 GLN 305 305 305 GLN GLN A . n A 1 306 LEU 306 306 306 LEU LEU A . n A 1 307 GLY 307 307 307 GLY GLY A . n A 1 308 ILE 308 308 308 ILE ILE A . n A 1 309 THR 309 309 309 THR THR A . n A 1 310 LYS 310 310 310 LYS LYS A . n A 1 311 VAL 311 311 311 VAL VAL A . n A 1 312 PHE 312 312 312 PHE PHE A . n A 1 313 SER 313 313 313 SER SER A . n A 1 314 ASN 314 314 314 ASN ASN A . n A 1 315 GLY 315 315 315 GLY GLY A . n A 1 316 ALA 316 316 316 ALA ALA A . n A 1 317 ASP 317 317 317 ASP ASP A . n A 1 318 LEU 318 318 318 LEU LEU A . n A 1 319 SER 319 319 319 SER SER A . n A 1 320 GLY 320 320 320 GLY GLY A . n A 1 321 VAL 321 321 321 VAL VAL A . n A 1 322 THR 322 322 322 THR THR A . n A 1 323 GLU 323 323 323 GLU GLU A . n A 1 324 GLU 324 324 324 GLU GLU A . n A 1 325 ALA 325 325 325 ALA ALA A . n A 1 326 PRO 326 326 326 PRO PRO A . n A 1 327 LEU 327 327 327 LEU LEU A . n A 1 328 LYS 328 328 328 LYS LYS A . n A 1 329 LEU 329 329 329 LEU LEU A . n A 1 330 SER 330 330 330 SER SER A . n A 1 331 LYS 331 331 331 LYS LYS A . n A 1 332 ALA 332 332 332 ALA ALA A . n A 1 333 VAL 333 333 333 VAL VAL A . n A 1 334 HIS 334 334 334 HIS HIS A . n A 1 335 LYS 335 335 335 LYS LYS A . n A 1 336 ALA 336 336 336 ALA ALA A . n A 1 337 VAL 337 337 337 VAL VAL A . n A 1 338 LEU 338 338 338 LEU LEU A . n A 1 339 THR 339 339 339 THR THR A . n A 1 340 ILE 340 340 340 ILE ILE A . n A 1 341 ASP 341 341 341 ASP ASP A . n A 1 342 GLU 342 342 342 GLU GLU A . n A 1 343 LYS 343 343 343 LYS LYS A . n A 1 344 GLY 344 344 344 GLY GLY A . n A 1 345 THR 345 345 345 THR THR A . n A 1 346 GLU 346 346 346 GLU GLU A . n A 1 347 ALA 347 347 347 ALA ALA A . n A 1 348 ALA 348 348 348 ALA ALA A . n A 1 349 GLY 349 349 349 GLY GLY A . n A 1 350 ALA 350 350 350 ALA ALA A . n A 1 351 MET 351 351 351 MET MET A . n A 1 352 PHE 352 352 352 PHE PHE A . n A 1 353 LEU 353 353 353 LEU LEU A . n A 1 354 GLU 354 354 354 GLU GLU A . n A 1 355 ALA 355 355 355 ALA ALA A . n A 1 356 ILE 356 356 356 ILE ILE A . n A 1 357 PRO 357 357 357 PRO PRO A . n A 1 358 MET 358 358 358 MET MET A . n A 1 359 SER 359 359 359 SER SER A . n A 1 360 ILE 360 360 360 ILE ILE A . n A 1 361 PRO 361 361 361 PRO PRO A . n A 1 362 PRO 362 362 362 PRO PRO A . n A 1 363 GLU 363 363 363 GLU GLU A . n A 1 364 VAL 364 364 364 VAL VAL A . n A 1 365 LYS 365 365 365 LYS LYS A . n A 1 366 PHE 366 366 366 PHE PHE A . n A 1 367 ASN 367 367 367 ASN ASN A . n A 1 368 LYS 368 368 368 LYS LYS A . n A 1 369 PRO 369 369 369 PRO PRO A . n A 1 370 PHE 370 370 370 PHE PHE A . n A 1 371 VAL 371 371 371 VAL VAL A . n A 1 372 PHE 372 372 372 PHE PHE A . n A 1 373 LEU 373 373 373 LEU LEU A . n A 1 374 MET 374 374 374 MET MET A . n A 1 375 ILE 375 375 375 ILE ILE A . n A 1 376 ASP 376 376 376 ASP ASP A . n A 1 377 GLN 377 377 377 GLN GLN A . n A 1 378 ASN 378 378 378 ASN ASN A . n A 1 379 THR 379 379 379 THR THR A . n A 1 380 LYS 380 380 380 LYS LYS A . n A 1 381 SER 381 381 381 SER SER A . n A 1 382 PRO 382 382 382 PRO PRO A . n A 1 383 LEU 383 383 383 LEU LEU A . n A 1 384 PHE 384 384 384 PHE PHE A . n A 1 385 MET 385 385 385 MET MET A . n A 1 386 GLY 386 386 386 GLY GLY A . n A 1 387 LYS 387 387 387 LYS LYS A . n A 1 388 VAL 388 388 388 VAL VAL A . n A 1 389 VAL 389 389 389 VAL VAL A . n A 1 390 ASN 390 390 390 ASN ASN A . n A 1 391 PRO 391 391 391 PRO PRO A . n A 1 392 THR 392 392 392 THR THR A . n A 1 393 GLN 393 393 393 GLN GLN A . n A 1 394 LYS 394 394 394 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 401 1 ZN ZN2 A . C 2 ZN 1 402 2 ZN ZN2 A . D 2 ZN 1 403 3 ZN ZN2 A . E 2 ZN 1 404 4 ZN ZN2 A . F 2 ZN 1 405 5 ZN ZN2 A . G 3 BME 1 432 232 BME CYS A . H 4 HOH 1 433 1 HOH TIP A . H 4 HOH 2 434 2 HOH TIP A . H 4 HOH 3 435 3 HOH TIP A . H 4 HOH 4 436 4 HOH TIP A . H 4 HOH 5 437 5 HOH TIP A . H 4 HOH 6 438 6 HOH TIP A . H 4 HOH 7 439 7 HOH TIP A . H 4 HOH 8 440 8 HOH TIP A . H 4 HOH 9 441 9 HOH TIP A . H 4 HOH 10 442 10 HOH TIP A . H 4 HOH 11 443 11 HOH TIP A . H 4 HOH 12 444 12 HOH TIP A . H 4 HOH 13 445 13 HOH TIP A . H 4 HOH 14 446 14 HOH TIP A . H 4 HOH 15 447 15 HOH TIP A . H 4 HOH 16 448 16 HOH TIP A . H 4 HOH 17 449 17 HOH TIP A . H 4 HOH 18 450 18 HOH TIP A . H 4 HOH 19 451 19 HOH TIP A . H 4 HOH 20 452 20 HOH TIP A . H 4 HOH 21 453 21 HOH TIP A . H 4 HOH 22 454 22 HOH TIP A . H 4 HOH 23 455 23 HOH TIP A . H 4 HOH 24 456 24 HOH TIP A . H 4 HOH 25 457 25 HOH TIP A . H 4 HOH 26 458 26 HOH TIP A . H 4 HOH 27 459 27 HOH TIP A . H 4 HOH 28 460 28 HOH TIP A . H 4 HOH 29 461 29 HOH TIP A . H 4 HOH 30 462 30 HOH TIP A . H 4 HOH 31 463 31 HOH TIP A . H 4 HOH 32 464 32 HOH TIP A . H 4 HOH 33 465 33 HOH TIP A . H 4 HOH 34 466 34 HOH TIP A . H 4 HOH 35 467 35 HOH TIP A . H 4 HOH 36 468 36 HOH TIP A . H 4 HOH 37 469 37 HOH TIP A . H 4 HOH 38 470 38 HOH TIP A . H 4 HOH 39 471 39 HOH TIP A . H 4 HOH 40 472 40 HOH TIP A . H 4 HOH 41 473 41 HOH TIP A . H 4 HOH 42 474 42 HOH TIP A . H 4 HOH 43 475 43 HOH TIP A . H 4 HOH 44 476 44 HOH TIP A . H 4 HOH 45 477 45 HOH TIP A . H 4 HOH 46 478 46 HOH TIP A . H 4 HOH 47 479 47 HOH TIP A . H 4 HOH 48 480 48 HOH TIP A . H 4 HOH 49 481 49 HOH TIP A . H 4 HOH 50 482 50 HOH TIP A . H 4 HOH 51 483 51 HOH TIP A . H 4 HOH 52 484 52 HOH TIP A . H 4 HOH 53 485 53 HOH TIP A . H 4 HOH 54 486 54 HOH TIP A . H 4 HOH 55 487 55 HOH TIP A . H 4 HOH 56 488 56 HOH TIP A . H 4 HOH 57 489 57 HOH TIP A . H 4 HOH 58 490 58 HOH TIP A . H 4 HOH 59 491 59 HOH TIP A . H 4 HOH 60 492 60 HOH TIP A . H 4 HOH 61 493 61 HOH TIP A . H 4 HOH 62 494 62 HOH TIP A . H 4 HOH 63 495 63 HOH TIP A . H 4 HOH 64 496 64 HOH TIP A . H 4 HOH 65 497 65 HOH TIP A . H 4 HOH 66 498 66 HOH TIP A . H 4 HOH 67 499 67 HOH TIP A . H 4 HOH 68 500 68 HOH TIP A . H 4 HOH 69 501 69 HOH TIP A . H 4 HOH 70 502 70 HOH TIP A . H 4 HOH 71 503 71 HOH TIP A . H 4 HOH 72 504 72 HOH TIP A . H 4 HOH 73 505 73 HOH TIP A . H 4 HOH 74 506 74 HOH TIP A . H 4 HOH 75 507 75 HOH TIP A . H 4 HOH 76 508 76 HOH TIP A . H 4 HOH 77 509 77 HOH TIP A . H 4 HOH 78 510 78 HOH TIP A . H 4 HOH 79 511 79 HOH TIP A . H 4 HOH 80 512 80 HOH TIP A . H 4 HOH 81 513 81 HOH TIP A . H 4 HOH 82 514 82 HOH TIP A . H 4 HOH 83 515 83 HOH TIP A . H 4 HOH 84 516 84 HOH TIP A . H 4 HOH 85 517 85 HOH TIP A . H 4 HOH 86 518 86 HOH TIP A . H 4 HOH 87 519 87 HOH TIP A . H 4 HOH 88 520 88 HOH TIP A . H 4 HOH 89 521 89 HOH TIP A . H 4 HOH 90 522 90 HOH TIP A . H 4 HOH 91 523 91 HOH TIP A . H 4 HOH 92 524 92 HOH TIP A . H 4 HOH 93 525 93 HOH TIP A . H 4 HOH 94 526 94 HOH TIP A . H 4 HOH 95 527 95 HOH TIP A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA,PQS dimeric 2 3 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F,G,H 2 1,2 A,B,C,D,E,F,G,H 3 1,3 A,B,C,D,E,F,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 3310 ? 2 MORE -288 ? 2 'SSA (A^2)' 33480 ? 3 'ABSA (A^2)' 2870 ? 3 MORE -282 ? 3 'SSA (A^2)' 33920 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 -x+y,y,-z+2/3 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 82.8600000000 3 'crystal symmetry operation' 4_665 -y+1,-x+1,-z+1/3 0.5000000000 -0.8660254038 0.0000000000 38.7850000000 -0.8660254038 -0.5000000000 0.0000000000 67.1775905716 0.0000000000 0.0000000000 -1.0000000000 41.4300000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 43 ? A HIS 43 ? 4_665 ZN ? D ZN . ? A ZN 403 ? 1_555 ND1 ? A HIS 262 ? A HIS 262 ? 1_555 84.0 ? 2 NE2 ? A HIS 43 ? A HIS 43 ? 4_665 ZN ? D ZN . ? A ZN 403 ? 1_555 O ? H HOH . ? A HOH 438 ? 1_555 111.6 ? 3 ND1 ? A HIS 262 ? A HIS 262 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 O ? H HOH . ? A HOH 438 ? 1_555 119.9 ? 4 NE2 ? A HIS 73 ? A HIS 73 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 OE1 ? A GLU 89 ? A GLU 89 ? 1_555 92.3 ? 5 NE2 ? A HIS 73 ? A HIS 73 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 123.0 ? 6 OE1 ? A GLU 89 ? A GLU 89 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 91.5 ? 7 NE2 ? A HIS 73 ? A HIS 73 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 O ? H HOH . ? A HOH 486 ? 1_555 92.6 ? 8 OE1 ? A GLU 89 ? A GLU 89 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 O ? H HOH . ? A HOH 486 ? 1_555 148.8 ? 9 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 O ? H HOH . ? A HOH 486 ? 1_555 111.3 ? 10 OE2 ? A GLU 98 ? A GLU 98 ? 5_555 ZN ? F ZN . ? A ZN 405 ? 1_555 OE1 ? A GLU 98 ? A GLU 98 ? 5_555 50.9 ? 11 OE2 ? A GLU 98 ? A GLU 98 ? 5_555 ZN ? F ZN . ? A ZN 405 ? 1_555 NE2 ? A HIS 101 ? A HIS 101 ? 1_555 133.0 ? 12 OE1 ? A GLU 98 ? A GLU 98 ? 5_555 ZN ? F ZN . ? A ZN 405 ? 1_555 NE2 ? A HIS 101 ? A HIS 101 ? 1_555 102.1 ? 13 OE2 ? A GLU 98 ? A GLU 98 ? 5_555 ZN ? F ZN . ? A ZN 405 ? 1_555 NE2 ? A HIS 139 ? A HIS 139 ? 1_555 108.5 ? 14 OE1 ? A GLU 98 ? A GLU 98 ? 5_555 ZN ? F ZN . ? A ZN 405 ? 1_555 NE2 ? A HIS 139 ? A HIS 139 ? 1_555 97.6 ? 15 NE2 ? A HIS 101 ? A HIS 101 ? 1_555 ZN ? F ZN . ? A ZN 405 ? 1_555 NE2 ? A HIS 139 ? A HIS 139 ? 1_555 113.3 ? 16 OE2 ? A GLU 151 ? A GLU 151 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 OE2 ? A GLU 175 ? A GLU 175 ? 1_555 82.4 ? 17 OE2 ? A GLU 151 ? A GLU 151 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 OE1 ? A GLU 175 ? A GLU 175 ? 1_555 128.3 ? 18 OE2 ? A GLU 175 ? A GLU 175 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 OE1 ? A GLU 175 ? A GLU 175 ? 1_555 54.1 ? 19 OE2 ? A GLU 151 ? A GLU 151 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 231 ? A HIS 231 ? 3_665 117.8 ? 20 OE2 ? A GLU 175 ? A GLU 175 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 231 ? A HIS 231 ? 3_665 138.9 ? 21 OE1 ? A GLU 175 ? A GLU 175 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 231 ? A HIS 231 ? 3_665 87.9 ? 22 OE2 ? A GLU 151 ? A GLU 151 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 OD1 ? A ASP 256 ? A ASP 256 ? 3_665 91.6 ? 23 OE2 ? A GLU 175 ? A GLU 175 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 OD1 ? A ASP 256 ? A ASP 256 ? 3_665 88.1 ? 24 OE1 ? A GLU 175 ? A GLU 175 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 OD1 ? A ASP 256 ? A ASP 256 ? 3_665 111.0 ? 25 NE2 ? A HIS 231 ? A HIS 231 ? 3_665 ZN ? C ZN . ? A ZN 402 ? 1_555 OD1 ? A ASP 256 ? A ASP 256 ? 3_665 123.8 ? 26 OG ? A SER 285 ? A SER 285 ? 1_555 ZN ? E ZN . ? A ZN 404 ? 1_555 NE2 ? A HIS 287 ? A HIS 287 ? 1_555 111.3 ? 27 OG ? A SER 285 ? A SER 285 ? 1_555 ZN ? E ZN . ? A ZN 404 ? 1_555 OE1 ? A GLU 324 ? A GLU 324 ? 5_545 109.4 ? 28 NE2 ? A HIS 287 ? A HIS 287 ? 1_555 ZN ? E ZN . ? A ZN 404 ? 1_555 OE1 ? A GLU 324 ? A GLU 324 ? 5_545 81.9 ? 29 OG ? A SER 285 ? A SER 285 ? 1_555 ZN ? E ZN . ? A ZN 404 ? 1_555 OE1 ? A GLU 363 ? A GLU 363 ? 1_555 88.2 ? 30 NE2 ? A HIS 287 ? A HIS 287 ? 1_555 ZN ? E ZN . ? A ZN 404 ? 1_555 OE1 ? A GLU 363 ? A GLU 363 ? 1_555 100.9 ? 31 OE1 ? A GLU 324 ? A GLU 324 ? 5_545 ZN ? E ZN . ? A ZN 404 ? 1_555 OE1 ? A GLU 363 ? A GLU 363 ? 1_555 160.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-03-14 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-04 5 'Structure model' 1 4 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' database_2 3 5 'Structure model' pdbx_struct_conn_angle 4 5 'Structure model' struct_conn 5 5 'Structure model' struct_ref_seq_dif 6 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 18 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 19 5 'Structure model' '_pdbx_struct_conn_angle.value' 20 5 'Structure model' '_struct_conn.pdbx_dist_value' 21 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 22 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 23 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 24 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 25 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 26 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 27 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 28 5 'Structure model' '_struct_conn.ptnr1_symmetry' 29 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 30 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 31 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 32 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 33 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 34 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 35 5 'Structure model' '_struct_conn.ptnr2_symmetry' 36 5 'Structure model' '_struct_ref_seq_dif.details' 37 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 38 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 39 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SHARP phasing . ? 1 CNS refinement . ? 2 SCALEPACK 'data scaling' . ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 512 ? ? O A HOH 523 ? ? 2.18 2 1 O A HOH 485 ? ? O A HOH 524 ? ? 2.18 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OD1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ASN _pdbx_validate_symm_contact.auth_seq_id_1 265 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OD1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ASN _pdbx_validate_symm_contact.auth_seq_id_2 265 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_665 _pdbx_validate_symm_contact.dist 2.08 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 81 ? ? 70.55 33.05 2 1 GLN A 105 ? ? -173.10 21.94 3 1 PRO A 106 ? ? -68.33 83.81 4 1 ASP A 107 ? ? -78.35 24.35 5 1 SER A 108 ? ? -69.52 -146.83 6 1 GLN A 111 ? ? -62.83 99.38 7 1 ASP A 171 ? ? 39.49 49.37 8 1 ASP A 211 ? ? -162.17 -169.99 9 1 THR A 345 ? ? -33.98 101.98 10 1 ALA A 347 ? ? 107.14 -21.11 11 1 ALA A 348 ? ? 154.69 172.22 12 1 ALA A 350 ? ? -59.43 39.65 13 1 MET A 351 ? ? 16.19 115.34 14 1 ASN A 378 ? ? -53.96 -75.42 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 1 ? A GLU 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A PRO 3 ? A PRO 3 4 1 Y 1 A GLN 4 ? A GLN 4 5 1 Y 1 A GLY 5 ? A GLY 5 6 1 Y 1 A ASP 6 ? A ASP 6 7 1 Y 1 A ALA 7 ? A ALA 7 8 1 Y 1 A ALA 8 ? A ALA 8 9 1 Y 1 A GLN 9 ? A GLN 9 10 1 Y 1 A LYS 10 ? A LYS 10 11 1 Y 1 A THR 11 ? A THR 11 12 1 Y 1 A ASP 12 ? A ASP 12 13 1 Y 1 A THR 13 ? A THR 13 14 1 Y 1 A SER 14 ? A SER 14 15 1 Y 1 A HIS 15 ? A HIS 15 16 1 Y 1 A HIS 16 ? A HIS 16 17 1 Y 1 A ASP 17 ? A ASP 17 18 1 Y 1 A GLN 18 ? A GLN 18 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 BETA-MERCAPTOETHANOL BME 4 water HOH #