data_1HPY # _entry.id 1HPY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1HPY pdb_00001hpy 10.2210/pdb1hpy/pdb WWPDB D_1000173965 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HPY _pdbx_database_status.recvd_initial_deposition_date 1998-09-30 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Marx, U.C.' 1 'Roesch, P.' 2 'Adermann, K.' 3 'Bayer, P.' 4 'Forssmann, W.-G.' 5 # _citation.id primary _citation.title ;Solution structures of human parathyroid hormone fragments hPTH(1-34) and hPTH(1-39) and bovine parathyroid hormone fragment bPTH(1-37). ; _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_volume 267 _citation.page_first 213 _citation.page_last 220 _citation.year 2000 _citation.journal_id_ASTM BBRCA9 _citation.country US _citation.journal_id_ISSN 0006-291X _citation.journal_id_CSD 0146 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10623601 _citation.pdbx_database_id_DOI 10.1006/bbrc.1999.1958 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Marx, U.C.' 1 ? primary 'Adermann, K.' 2 ? primary 'Bayer, P.' 3 ? primary 'Forssmann, W.G.' 4 ? primary 'Rosch, P.' 5 ? # _cell.entry_id 1HPY _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1HPY _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PARATHYROID HORMONE' _entity.formula_weight 4125.778 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RESIDUES 1-34' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF _entity_poly.pdbx_seq_one_letter_code_can SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 VAL n 1 3 SER n 1 4 GLU n 1 5 ILE n 1 6 GLN n 1 7 LEU n 1 8 MET n 1 9 HIS n 1 10 ASN n 1 11 LEU n 1 12 GLY n 1 13 LYS n 1 14 HIS n 1 15 LEU n 1 16 ASN n 1 17 SER n 1 18 MET n 1 19 GLU n 1 20 ARG n 1 21 VAL n 1 22 GLU n 1 23 TRP n 1 24 LEU n 1 25 ARG n 1 26 LYS n 1 27 LYS n 1 28 LEU n 1 29 GLN n 1 30 ASP n 1 31 VAL n 1 32 HIS n 1 33 ASN n 1 34 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTHY_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01270 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQ RPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1HPY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 34 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01270 _struct_ref_seq.db_align_beg 32 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 65 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 34 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 COSY 1 3 1 TOCSY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20% TFE/80% H2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AMX600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1HPY _pdbx_nmr_refine.method 'SIMULATED ANNEALING, RESTRAINED MOLECULAR DYNAMICS' _pdbx_nmr_refine.details ;THE STRUCTURE CALCULATION FOLLOWED STANDARD PROCEDURES EMPLOYING A HYBRID DISTANCE GEOMETRY MOLECULAR DYNAMICS APPROACH WITH SIMULATED ANNEALING REFINEMENT AND SUBSEQUENT ENERGY MINIMIZATION. FOR THE REFINEMENT THE DIELECTRIC CONSTANT WAS CHANGED TO 4. STRUCTURE PARAMETERS WERE EXTRACTED FROM THE STANDARD FILES PARALLHDG.PRO AND TOPALLHDG.PRO OF X-PLOR 3.1. IN EACH ROUND OF THE STRUCTURE CALCULATION 30 STRUCTURES WERE CALCULATED. OF THE 30 STRUCTURES RESULTING FROM THE FINAL ROUND OF STRUCTURE CALCULATION, THOSE 10 STRUCTURES THAT SHOWED THE LOWEST TOTAL ENERGY VALUES WERE SELECTED FOR FURTHER CHARACTERIZATION. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1HPY _pdbx_nmr_details.text 'THE DISTANCE RESTRAINTS USED FOR STRUCTURE CALCULATION WERE OBTAINED FROM TWO-DIMENSIONAL HOMONUCLEAR 1H-NOESY SPECTRA.' # _pdbx_nmr_ensemble.entry_id 1HPY _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'ENERGY, AGREEMENT WITH EXPERIMENTAL DATA' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' NDEE ? ? 2 'structure solution' X-PLOR ? ? 3 # _exptl.entry_id 1HPY _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1HPY _struct.title 'THE SOLUTION STRUCTURE OF HUMAN PARATHYROID HORMONE FRAGMENT 1-34 IN 20% TRIFLUORETHANOL, NMR, 10 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1HPY _struct_keywords.pdbx_keywords 'PEPTIDE HORMONE' _struct_keywords.text 'PEPTIDE HORMONE, SOLUTION STRUCTURE, HUMAN PARATHYROID HORMONE, TRIFLUORETHANOL' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 4 ? LYS A 13 ? GLU A 4 LYS A 13 1 ? 10 HELX_P HELX_P2 2 ARG A 20 ? GLN A 29 ? ARG A 20 GLN A 29 5 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1HPY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1HPY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 PHE 34 34 34 PHE PHE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-01-14 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A VAL 21 ? ? H A ARG 25 ? ? 1.57 2 3 O A VAL 21 ? ? H A ARG 25 ? ? 1.58 3 5 O A VAL 21 ? ? H A ARG 25 ? ? 1.58 4 8 O A VAL 21 ? ? H A ARG 25 ? ? 1.59 5 9 O A VAL 21 ? ? H A ARG 25 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? -160.81 -59.70 2 1 ASN A 16 ? ? -139.93 -45.46 3 1 MET A 18 ? ? 67.63 125.65 4 1 GLU A 19 ? ? 75.20 -60.90 5 1 HIS A 32 ? ? -126.45 -65.05 6 1 ASN A 33 ? ? -167.25 -54.66 7 2 SER A 3 ? ? 71.97 130.48 8 2 GLU A 4 ? ? 85.48 -42.34 9 2 ASN A 16 ? ? 70.72 -56.55 10 2 SER A 17 ? ? -85.94 -80.08 11 2 ASP A 30 ? ? -89.61 -138.62 12 2 HIS A 32 ? ? 97.34 -175.00 13 2 ASN A 33 ? ? -51.59 -71.23 14 3 SER A 3 ? ? -126.99 -66.57 15 3 HIS A 9 ? ? -88.29 -83.35 16 3 ASN A 10 ? ? 70.86 -42.89 17 3 HIS A 14 ? ? -172.89 24.11 18 3 SER A 17 ? ? 84.38 -27.60 19 3 VAL A 31 ? ? -101.74 53.24 20 4 GLU A 4 ? ? 85.08 -45.99 21 4 SER A 17 ? ? -143.13 -57.52 22 4 ASP A 30 ? ? -120.07 -165.17 23 4 ASN A 33 ? ? -120.73 -55.96 24 5 SER A 3 ? ? 73.35 131.04 25 5 GLU A 4 ? ? 83.25 -48.46 26 5 SER A 17 ? ? -125.04 -146.41 27 5 VAL A 21 ? ? -39.73 -39.37 28 5 ASP A 30 ? ? -100.21 -148.35 29 5 ASN A 33 ? ? -161.12 32.22 30 6 LYS A 13 ? ? -95.22 39.17 31 6 HIS A 14 ? ? -134.71 -55.68 32 6 MET A 18 ? ? -158.80 -47.58 33 6 ASN A 33 ? ? -149.70 -56.20 34 7 VAL A 2 ? ? 62.35 140.30 35 7 SER A 3 ? ? -122.80 -56.89 36 7 HIS A 14 ? ? -74.53 -149.24 37 7 ASN A 16 ? ? 81.04 -26.81 38 7 SER A 17 ? ? 82.12 -47.38 39 7 ASP A 30 ? ? -121.86 -148.78 40 7 HIS A 32 ? ? -176.57 122.47 41 8 VAL A 2 ? ? 77.10 -55.69 42 8 HIS A 14 ? ? -75.42 -94.69 43 8 LEU A 15 ? ? 68.15 -60.80 44 8 ASN A 33 ? ? 76.19 -63.02 45 9 SER A 3 ? ? -141.17 -74.11 46 9 SER A 17 ? ? -142.22 -55.37 47 9 GLU A 19 ? ? -94.77 41.89 48 9 ARG A 20 ? ? -152.20 -56.80 49 9 VAL A 21 ? ? -39.85 -39.31 50 9 ASP A 30 ? ? -124.18 -144.66 51 9 VAL A 31 ? ? 68.48 -78.60 52 10 SER A 3 ? ? 68.06 111.83 53 10 GLU A 4 ? ? 83.64 -44.25 54 10 LEU A 15 ? ? -88.82 41.41 55 10 ASN A 16 ? ? -158.83 -54.24 56 10 VAL A 21 ? ? -37.36 -38.24 57 10 ASP A 30 ? ? -98.80 35.20 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 20 ? ? 0.280 'SIDE CHAIN' 2 1 ARG A 25 ? ? 0.292 'SIDE CHAIN' 3 2 ARG A 20 ? ? 0.316 'SIDE CHAIN' 4 2 ARG A 25 ? ? 0.292 'SIDE CHAIN' 5 3 ARG A 20 ? ? 0.306 'SIDE CHAIN' 6 3 ARG A 25 ? ? 0.312 'SIDE CHAIN' 7 4 ARG A 20 ? ? 0.290 'SIDE CHAIN' 8 4 ARG A 25 ? ? 0.289 'SIDE CHAIN' 9 5 ARG A 20 ? ? 0.300 'SIDE CHAIN' 10 5 ARG A 25 ? ? 0.303 'SIDE CHAIN' 11 6 ARG A 20 ? ? 0.316 'SIDE CHAIN' 12 6 ARG A 25 ? ? 0.307 'SIDE CHAIN' 13 7 ARG A 20 ? ? 0.315 'SIDE CHAIN' 14 7 ARG A 25 ? ? 0.295 'SIDE CHAIN' 15 8 ARG A 20 ? ? 0.316 'SIDE CHAIN' 16 8 ARG A 25 ? ? 0.316 'SIDE CHAIN' 17 9 ARG A 20 ? ? 0.317 'SIDE CHAIN' 18 9 ARG A 25 ? ? 0.313 'SIDE CHAIN' 19 10 ARG A 20 ? ? 0.283 'SIDE CHAIN' 20 10 ARG A 25 ? ? 0.316 'SIDE CHAIN' #