data_1HRP # _entry.id 1HRP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1HRP WWPDB D_1000173981 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HRP _pdbx_database_status.recvd_initial_deposition_date 1994-08-15 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lapthorn, A.J.' 1 'Harris, D.C.' 2 'Isaacs, N.W.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Crystal structure of human chorionic gonadotropin.' Nature 369 455 461 1994 NATUAS UK 0028-0836 0006 ? 8202136 10.1038/369455a0 1 'Preliminary X-Ray Diffraction Analysis of Human Chorionic Gonadotropin' J.Biol.Chem. 264 6705 ? 1989 JBCHA3 US 0021-9258 0071 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lapthorn, A.J.' 1 ? primary 'Harris, D.C.' 2 ? primary 'Littlejohn, A.' 3 ? primary 'Lustbader, J.W.' 4 ? primary 'Canfield, R.E.' 5 ? primary 'Machin, K.J.' 6 ? primary 'Morgan, F.J.' 7 ? primary 'Isaacs, N.W.' 8 ? 1 'Harris, D.C.' 9 ? 1 'Machin, K.J.' 10 ? 1 'Evin, G.M.' 11 ? 1 'Morgan, F.J.' 12 ? 1 'Isaacs, N.W.' 13 ? # _cell.entry_id 1HRP _cell.length_a 88.680 _cell.length_b 88.680 _cell.length_c 177.240 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1HRP _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HUMAN CHORIONIC GONADOTROPIN' 10219.741 1 ? ? ? ? 2 polymer man 'HUMAN CHORIONIC GONADOTROPIN' 15548.979 1 ? ? ? ? 3 branched man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401 2 ? ? ? ? 4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 2 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;APDTQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHT ACHCSTCYYHKS ; ;APDTQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHT ACHCSTCYYHKS ; A ? 2 'polypeptide(L)' no no ;SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVV SYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ ; ;SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVV SYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ ; B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 PRO n 1 3 ASP n 1 4 THR n 1 5 GLN n 1 6 ASP n 1 7 CYS n 1 8 PRO n 1 9 GLU n 1 10 CYS n 1 11 THR n 1 12 LEU n 1 13 GLN n 1 14 GLU n 1 15 ASN n 1 16 PRO n 1 17 PHE n 1 18 PHE n 1 19 SER n 1 20 GLN n 1 21 PRO n 1 22 GLY n 1 23 ALA n 1 24 PRO n 1 25 ILE n 1 26 LEU n 1 27 GLN n 1 28 CYS n 1 29 MET n 1 30 GLY n 1 31 CYS n 1 32 CYS n 1 33 PHE n 1 34 SER n 1 35 ARG n 1 36 ALA n 1 37 TYR n 1 38 PRO n 1 39 THR n 1 40 PRO n 1 41 LEU n 1 42 ARG n 1 43 SER n 1 44 LYS n 1 45 LYS n 1 46 THR n 1 47 MET n 1 48 LEU n 1 49 VAL n 1 50 GLN n 1 51 LYS n 1 52 ASN n 1 53 VAL n 1 54 THR n 1 55 SER n 1 56 GLU n 1 57 SER n 1 58 THR n 1 59 CYS n 1 60 CYS n 1 61 VAL n 1 62 ALA n 1 63 LYS n 1 64 SER n 1 65 TYR n 1 66 ASN n 1 67 ARG n 1 68 VAL n 1 69 THR n 1 70 VAL n 1 71 MET n 1 72 GLY n 1 73 GLY n 1 74 PHE n 1 75 LYS n 1 76 VAL n 1 77 GLU n 1 78 ASN n 1 79 HIS n 1 80 THR n 1 81 ALA n 1 82 CYS n 1 83 HIS n 1 84 CYS n 1 85 SER n 1 86 THR n 1 87 CYS n 1 88 TYR n 1 89 TYR n 1 90 HIS n 1 91 LYS n 1 92 SER n 2 1 SER n 2 2 LYS n 2 3 GLU n 2 4 PRO n 2 5 LEU n 2 6 ARG n 2 7 PRO n 2 8 ARG n 2 9 CYS n 2 10 ARG n 2 11 PRO n 2 12 ILE n 2 13 ASN n 2 14 ALA n 2 15 THR n 2 16 LEU n 2 17 ALA n 2 18 VAL n 2 19 GLU n 2 20 LYS n 2 21 GLU n 2 22 GLY n 2 23 CYS n 2 24 PRO n 2 25 VAL n 2 26 CYS n 2 27 ILE n 2 28 THR n 2 29 VAL n 2 30 ASN n 2 31 THR n 2 32 THR n 2 33 ILE n 2 34 CYS n 2 35 ALA n 2 36 GLY n 2 37 TYR n 2 38 CYS n 2 39 PRO n 2 40 THR n 2 41 MET n 2 42 THR n 2 43 ARG n 2 44 VAL n 2 45 LEU n 2 46 GLN n 2 47 GLY n 2 48 VAL n 2 49 LEU n 2 50 PRO n 2 51 ALA n 2 52 LEU n 2 53 PRO n 2 54 GLN n 2 55 VAL n 2 56 VAL n 2 57 CYS n 2 58 ASN n 2 59 TYR n 2 60 ARG n 2 61 ASP n 2 62 VAL n 2 63 ARG n 2 64 PHE n 2 65 GLU n 2 66 SER n 2 67 ILE n 2 68 ARG n 2 69 LEU n 2 70 PRO n 2 71 GLY n 2 72 CYS n 2 73 PRO n 2 74 ARG n 2 75 GLY n 2 76 VAL n 2 77 ASN n 2 78 PRO n 2 79 VAL n 2 80 VAL n 2 81 SER n 2 82 TYR n 2 83 ALA n 2 84 VAL n 2 85 ALA n 2 86 LEU n 2 87 SER n 2 88 CYS n 2 89 GLN n 2 90 CYS n 2 91 ALA n 2 92 LEU n 2 93 CYS n 2 94 ARG n 2 95 ARG n 2 96 SER n 2 97 THR n 2 98 THR n 2 99 ASP n 2 100 CYS n 2 101 GLY n 2 102 GLY n 2 103 PRO n 2 104 LYS n 2 105 ASP n 2 106 HIS n 2 107 PRO n 2 108 LEU n 2 109 THR n 2 110 CYS n 2 111 ASP n 2 112 ASP n 2 113 PRO n 2 114 ARG n 2 115 PHE n 2 116 GLN n 2 117 ASP n 2 118 SER n 2 119 SER n 2 120 SER n 2 121 SER n 2 122 LYS n 2 123 ALA n 2 124 PRO n 2 125 PRO n 2 126 PRO n 2 127 SER n 2 128 LEU n 2 129 PRO n 2 130 SER n 2 131 PRO n 2 132 SER n 2 133 ARG n 2 134 LEU n 2 135 PRO n 2 136 GLY n 2 137 PRO n 2 138 SER n 2 139 ASP n 2 140 THR n 2 141 PRO n 2 142 ILE n 2 143 LEU n 2 144 PRO n 2 145 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue placenta _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_db_accession _struct_ref.pdbx_align_begin _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_db_isoform 1 UNP GLHA_HUMAN 1 P01215 1 ;MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSE STCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS ; ? 2 UNP CGHB_HUMAN 2 P01233 1 ;MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYR DVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDT PILPQ ; ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1HRP A 1 ? 92 ? P01215 25 ? 116 ? 1 92 2 2 1HRP B 1 ? 145 ? P01233 21 ? 165 ? 1 145 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1HRP _struct_ref_seq_dif.mon_id THR _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 4 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P01215 _struct_ref_seq_dif.db_mon_id VAL _struct_ref_seq_dif.pdbx_seq_db_seq_num 28 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 4 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1HRP _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.90 _exptl_crystal.density_percent_sol 68.46 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _reflns.entry_id 1HRP _reflns.observed_criterion_sigma_I 2. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low ? _reflns.d_resolution_high ? _reflns.number_obs 8365 _reflns.number_all ? _reflns.percent_possible_obs 94.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 1HRP _refine.ls_number_reflns_obs 7877 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2. _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10. _refine.ls_d_res_high 3.0 _refine.ls_percent_reflns_obs 92.4 _refine.ls_R_factor_obs 0.218 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.218 _refine.ls_R_factor_R_free 0.314 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 26.5 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ;IN FINAL CYCLES OF REFINEMENT, 1/2 THE STANDARD X-PLOR WEIGHT WAS APPLIED. ; _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1HRP _refine_analyze.Luzzati_coordinate_error_obs 0.5 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1466 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 84 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1550 _refine_hist.d_res_high 3.0 _refine_hist.d_res_low 10. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.018 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 2.28 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1HRP _struct.title 'CRYSTAL STRUCTURE OF HUMAN CHORIONIC GONADOTROPIN' _struct.pdbx_descriptor 'HUMAN CHORIONIC GONADOTROPIN (HCG)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1HRP _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text HORMONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 4 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 40 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 45 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 40 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 45 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 7 A CYS 31 1_555 ? ? ? ? ? ? ? 2.023 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 60 SG ? ? A CYS 10 A CYS 60 1_555 ? ? ? ? ? ? ? 2.025 ? ? disulf3 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 82 SG ? ? A CYS 28 A CYS 82 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf4 disulf ? ? A CYS 32 SG ? ? ? 1_555 A CYS 84 SG ? ? A CYS 32 A CYS 84 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf5 disulf ? ? A CYS 59 SG ? ? ? 1_555 A CYS 87 SG ? ? A CYS 59 A CYS 87 1_555 ? ? ? ? ? ? ? 2.007 ? ? disulf6 disulf ? ? B CYS 9 SG ? ? ? 1_555 B CYS 57 SG ? ? B CYS 9 B CYS 57 1_555 ? ? ? ? ? ? ? 2.013 ? ? disulf7 disulf ? ? B CYS 23 SG ? ? ? 1_555 B CYS 72 SG ? ? B CYS 23 B CYS 72 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf8 disulf ? ? B CYS 26 SG ? ? ? 1_555 B CYS 110 SG ? ? B CYS 26 B CYS 110 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf9 disulf ? ? B CYS 34 SG ? ? ? 1_555 B CYS 88 SG ? ? B CYS 34 B CYS 88 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf10 disulf ? ? B CYS 38 SG ? ? ? 1_555 B CYS 90 SG ? ? B CYS 38 B CYS 90 1_555 ? ? ? ? ? ? ? 2.004 ? ? disulf11 disulf ? ? B CYS 93 SG ? ? ? 1_555 B CYS 100 SG ? ? B CYS 93 B CYS 100 1_555 ? ? ? ? ? ? ? 2.008 ? ? covale1 covale one ? A ASN 52 ND2 ? ? ? 1_555 D NAG . C1 ? ? A ASN 52 D NAG 1 1_555 ? ? ? ? ? ? ? 1.442 ? N-Glycosylation covale2 covale one ? A ASN 78 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 78 C NAG 1 1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation covale3 covale one ? B ASN 13 ND2 ? ? ? 1_555 E NAG . C1 ? ? B ASN 13 B NAG 146 1_555 ? ? ? ? ? ? ? 1.466 ? N-Glycosylation covale4 covale one ? B ASN 30 ND2 ? ? ? 1_555 F NAG . C1 ? ? B ASN 30 B NAG 147 1_555 ? ? ? ? ? ? ? 1.469 ? N-Glycosylation covale5 covale both ? C NAG . O4 ? ? ? 1_555 C NAG . C1 ? ? C NAG 1 C NAG 2 1_555 ? ? ? ? ? ? ? 1.378 ? ? covale6 covale both ? D NAG . O4 ? ? ? 1_555 D NAG . C1 ? ? D NAG 1 D NAG 2 1_555 ? ? ? ? ? ? ? 1.376 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 65 ? ARG A 67 ? TYR A 65 ARG A 67 A 2 GLU A 77 ? HIS A 79 ? GLU A 77 HIS A 79 B 1 VAL B 55 ? TYR B 59 ? VAL B 55 TYR B 59 B 2 CYS B 88 ? LEU B 92 ? CYS B 88 LEU B 92 C 1 VAL B 62 ? GLU B 65 ? VAL B 62 GLU B 65 C 2 TYR B 82 ? ALA B 85 ? TYR B 82 ALA B 85 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ASN A 66 ? O ASN A 66 N ASN A 78 ? N ASN A 78 B 1 2 N ASN B 58 ? N ASN B 58 O GLN B 89 ? O GLN B 89 C 1 2 O GLU B 65 ? O GLU B 65 N TYR B 82 ? N TYR B 82 # _database_PDB_matrix.entry_id 1HRP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1HRP _atom_sites.fract_transf_matrix[1][1] 0.011276 _atom_sites.fract_transf_matrix[1][2] 0.006510 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013021 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005642 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 CYS 82 82 82 CYS CYS A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 CYS 87 87 87 CYS CYS A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 HIS 90 90 ? ? ? A . n A 1 91 LYS 91 91 ? ? ? A . n A 1 92 SER 92 92 ? ? ? A . n B 2 1 SER 1 1 ? ? ? B . n B 2 2 LYS 2 2 2 LYS LYS B . n B 2 3 GLU 3 3 3 GLU GLU B . n B 2 4 PRO 4 4 4 PRO PRO B . n B 2 5 LEU 5 5 5 LEU LEU B . n B 2 6 ARG 6 6 6 ARG ARG B . n B 2 7 PRO 7 7 7 PRO PRO B . n B 2 8 ARG 8 8 8 ARG ARG B . n B 2 9 CYS 9 9 9 CYS CYS B . n B 2 10 ARG 10 10 10 ARG ARG B . n B 2 11 PRO 11 11 11 PRO PRO B . n B 2 12 ILE 12 12 12 ILE ILE B . n B 2 13 ASN 13 13 13 ASN ASN B . n B 2 14 ALA 14 14 14 ALA ALA B . n B 2 15 THR 15 15 15 THR THR B . n B 2 16 LEU 16 16 16 LEU LEU B . n B 2 17 ALA 17 17 17 ALA ALA B . n B 2 18 VAL 18 18 18 VAL VAL B . n B 2 19 GLU 19 19 19 GLU GLU B . n B 2 20 LYS 20 20 20 LYS LYS B . n B 2 21 GLU 21 21 21 GLU GLU B . n B 2 22 GLY 22 22 22 GLY GLY B . n B 2 23 CYS 23 23 23 CYS CYS B . n B 2 24 PRO 24 24 24 PRO PRO B . n B 2 25 VAL 25 25 25 VAL VAL B . n B 2 26 CYS 26 26 26 CYS CYS B . n B 2 27 ILE 27 27 27 ILE ILE B . n B 2 28 THR 28 28 28 THR THR B . n B 2 29 VAL 29 29 29 VAL VAL B . n B 2 30 ASN 30 30 30 ASN ASN B . n B 2 31 THR 31 31 31 THR THR B . n B 2 32 THR 32 32 32 THR THR B . n B 2 33 ILE 33 33 33 ILE ILE B . n B 2 34 CYS 34 34 34 CYS CYS B . n B 2 35 ALA 35 35 35 ALA ALA B . n B 2 36 GLY 36 36 36 GLY GLY B . n B 2 37 TYR 37 37 37 TYR TYR B . n B 2 38 CYS 38 38 38 CYS CYS B . n B 2 39 PRO 39 39 39 PRO PRO B . n B 2 40 THR 40 40 40 THR THR B . n B 2 41 MET 41 41 41 MET MET B . n B 2 42 THR 42 42 42 THR THR B . n B 2 43 ARG 43 43 43 ARG ARG B . n B 2 44 VAL 44 44 44 VAL VAL B . n B 2 45 LEU 45 45 45 LEU LEU B . n B 2 46 GLN 46 46 46 GLN GLN B . n B 2 47 GLY 47 47 47 GLY GLY B . n B 2 48 VAL 48 48 48 VAL VAL B . n B 2 49 LEU 49 49 49 LEU LEU B . n B 2 50 PRO 50 50 50 PRO PRO B . n B 2 51 ALA 51 51 51 ALA ALA B . n B 2 52 LEU 52 52 52 LEU LEU B . n B 2 53 PRO 53 53 53 PRO PRO B . n B 2 54 GLN 54 54 54 GLN GLN B . n B 2 55 VAL 55 55 55 VAL VAL B . n B 2 56 VAL 56 56 56 VAL VAL B . n B 2 57 CYS 57 57 57 CYS CYS B . n B 2 58 ASN 58 58 58 ASN ASN B . n B 2 59 TYR 59 59 59 TYR TYR B . n B 2 60 ARG 60 60 60 ARG ARG B . n B 2 61 ASP 61 61 61 ASP ASP B . n B 2 62 VAL 62 62 62 VAL VAL B . n B 2 63 ARG 63 63 63 ARG ARG B . n B 2 64 PHE 64 64 64 PHE PHE B . n B 2 65 GLU 65 65 65 GLU GLU B . n B 2 66 SER 66 66 66 SER SER B . n B 2 67 ILE 67 67 67 ILE ILE B . n B 2 68 ARG 68 68 68 ARG ARG B . n B 2 69 LEU 69 69 69 LEU LEU B . n B 2 70 PRO 70 70 70 PRO PRO B . n B 2 71 GLY 71 71 71 GLY GLY B . n B 2 72 CYS 72 72 72 CYS CYS B . n B 2 73 PRO 73 73 73 PRO PRO B . n B 2 74 ARG 74 74 74 ARG ARG B . n B 2 75 GLY 75 75 75 GLY GLY B . n B 2 76 VAL 76 76 76 VAL VAL B . n B 2 77 ASN 77 77 77 ASN ASN B . n B 2 78 PRO 78 78 78 PRO PRO B . n B 2 79 VAL 79 79 79 VAL VAL B . n B 2 80 VAL 80 80 80 VAL VAL B . n B 2 81 SER 81 81 81 SER SER B . n B 2 82 TYR 82 82 82 TYR TYR B . n B 2 83 ALA 83 83 83 ALA ALA B . n B 2 84 VAL 84 84 84 VAL VAL B . n B 2 85 ALA 85 85 85 ALA ALA B . n B 2 86 LEU 86 86 86 LEU LEU B . n B 2 87 SER 87 87 87 SER SER B . n B 2 88 CYS 88 88 88 CYS CYS B . n B 2 89 GLN 89 89 89 GLN GLN B . n B 2 90 CYS 90 90 90 CYS CYS B . n B 2 91 ALA 91 91 91 ALA ALA B . n B 2 92 LEU 92 92 92 LEU LEU B . n B 2 93 CYS 93 93 93 CYS CYS B . n B 2 94 ARG 94 94 94 ARG ARG B . n B 2 95 ARG 95 95 95 ARG ARG B . n B 2 96 SER 96 96 96 SER SER B . n B 2 97 THR 97 97 97 THR THR B . n B 2 98 THR 98 98 98 THR THR B . n B 2 99 ASP 99 99 99 ASP ASP B . n B 2 100 CYS 100 100 100 CYS CYS B . n B 2 101 GLY 101 101 101 GLY GLY B . n B 2 102 GLY 102 102 102 GLY GLY B . n B 2 103 PRO 103 103 103 PRO PRO B . n B 2 104 LYS 104 104 104 LYS LYS B . n B 2 105 ASP 105 105 105 ASP ASP B . n B 2 106 HIS 106 106 106 HIS HIS B . n B 2 107 PRO 107 107 107 PRO PRO B . n B 2 108 LEU 108 108 108 LEU LEU B . n B 2 109 THR 109 109 109 THR THR B . n B 2 110 CYS 110 110 110 CYS CYS B . n B 2 111 ASP 111 111 111 ASP ASP B . n B 2 112 ASP 112 112 ? ? ? B . n B 2 113 PRO 113 113 ? ? ? B . n B 2 114 ARG 114 114 ? ? ? B . n B 2 115 PHE 115 115 ? ? ? B . n B 2 116 GLN 116 116 ? ? ? B . n B 2 117 ASP 117 117 ? ? ? B . n B 2 118 SER 118 118 ? ? ? B . n B 2 119 SER 119 119 ? ? ? B . n B 2 120 SER 120 120 ? ? ? B . n B 2 121 SER 121 121 ? ? ? B . n B 2 122 LYS 122 122 ? ? ? B . n B 2 123 ALA 123 123 ? ? ? B . n B 2 124 PRO 124 124 ? ? ? B . n B 2 125 PRO 125 125 ? ? ? B . n B 2 126 PRO 126 126 ? ? ? B . n B 2 127 SER 127 127 ? ? ? B . n B 2 128 LEU 128 128 ? ? ? B . n B 2 129 PRO 129 129 ? ? ? B . n B 2 130 SER 130 130 ? ? ? B . n B 2 131 PRO 131 131 ? ? ? B . n B 2 132 SER 132 132 ? ? ? B . n B 2 133 ARG 133 133 ? ? ? B . n B 2 134 LEU 134 134 ? ? ? B . n B 2 135 PRO 135 135 ? ? ? B . n B 2 136 GLY 136 136 ? ? ? B . n B 2 137 PRO 137 137 ? ? ? B . n B 2 138 SER 138 138 ? ? ? B . n B 2 139 ASP 139 139 ? ? ? B . n B 2 140 THR 140 140 ? ? ? B . n B 2 141 PRO 141 141 ? ? ? B . n B 2 142 ILE 142 142 ? ? ? B . n B 2 143 LEU 143 143 ? ? ? B . n B 2 144 PRO 144 144 ? ? ? B . n B 2 145 GLN 145 145 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 4 NAG 1 146 1 NAG NAG B . F 4 NAG 1 147 11 NAG NAG B . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A ASN 52 A ASN 52 ? ASN 'GLYCOSYLATION SITE' 2 A ASN 78 A ASN 78 ? ASN 'GLYCOSYLATION SITE' 3 B ASN 13 B ASN 13 ? ASN 'GLYCOSYLATION SITE' 4 B ASN 30 B ASN 30 ? ASN 'GLYCOSYLATION SITE' # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 software_defined_assembly PISA tetrameric 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F 2 1,2 A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5790 ? 1 MORE 1 ? 1 'SSA (A^2)' 11460 ? 2 'ABSA (A^2)' 13780 ? 2 MORE -19 ? 2 'SSA (A^2)' 20720 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+1/6 0.5000000000 -0.8660254038 0.0000000000 44.3400000000 -0.8660254038 -0.5000000000 0.0000000000 76.7991328076 0.0000000000 0.0000000000 -1.0000000000 29.5400000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-11-01 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Non-polymer description' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Atomic model' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' Other 9 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' chem_comp 3 4 'Structure model' entity 4 4 'Structure model' pdbx_branch_scheme 5 4 'Structure model' pdbx_chem_comp_identifier 6 4 'Structure model' pdbx_database_status 7 4 'Structure model' pdbx_entity_branch 8 4 'Structure model' pdbx_entity_branch_descriptor 9 4 'Structure model' pdbx_entity_branch_link 10 4 'Structure model' pdbx_entity_branch_list 11 4 'Structure model' pdbx_entity_nonpoly 12 4 'Structure model' pdbx_nonpoly_scheme 13 4 'Structure model' pdbx_struct_assembly_gen 14 4 'Structure model' struct_asym 15 4 'Structure model' struct_conn 16 4 'Structure model' struct_ref_seq_dif 17 4 'Structure model' struct_site 18 4 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.auth_asym_id' 2 4 'Structure model' '_atom_site.auth_seq_id' 3 4 'Structure model' '_atom_site.label_asym_id' 4 4 'Structure model' '_atom_site.label_entity_id' 5 4 'Structure model' '_chem_comp.name' 6 4 'Structure model' '_chem_comp.type' 7 4 'Structure model' '_pdbx_database_status.process_site' 8 4 'Structure model' '_pdbx_entity_nonpoly.entity_id' 9 4 'Structure model' '_pdbx_entity_nonpoly.name' 10 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 11 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 12 4 'Structure model' '_struct_conn.pdbx_role' 13 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 14 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 15 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 16 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 17 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 19 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C B ARG 6 ? ? N B PRO 7 ? ? CA B PRO 7 ? ? 128.47 119.30 9.17 1.50 Y 2 1 C B GLY 102 ? ? N B PRO 103 ? ? CA B PRO 103 ? ? 129.87 119.30 10.57 1.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 23 ? ? -171.41 62.77 2 1 LYS A 45 ? ? -76.25 22.40 3 1 LYS A 75 ? ? -112.69 78.14 4 1 THR A 80 ? ? -143.43 26.26 5 1 ALA A 81 ? ? 169.36 131.17 6 1 THR A 86 ? ? -39.25 132.22 7 1 CYS B 9 ? ? -35.89 116.91 8 1 GLN B 46 ? ? -84.71 -148.96 9 1 VAL B 48 ? ? -32.17 76.54 10 1 PRO B 50 ? ? 0.90 63.30 11 1 ALA B 51 ? ? -14.77 124.53 12 1 ARG B 60 ? ? -119.62 -80.57 13 1 HIS B 106 ? ? 43.63 74.51 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 88 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.066 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A THR 4 ? OG1 ? A THR 4 OG1 2 1 Y 1 A THR 4 ? CG2 ? A THR 4 CG2 3 1 Y 1 A GLN 5 ? CG ? A GLN 5 CG 4 1 Y 1 A GLN 5 ? CD ? A GLN 5 CD 5 1 Y 1 A GLN 5 ? OE1 ? A GLN 5 OE1 6 1 Y 1 A GLN 5 ? NE2 ? A GLN 5 NE2 7 1 Y 1 A TYR 89 ? CG ? A TYR 89 CG 8 1 Y 1 A TYR 89 ? CD1 ? A TYR 89 CD1 9 1 Y 1 A TYR 89 ? CD2 ? A TYR 89 CD2 10 1 Y 1 A TYR 89 ? CE1 ? A TYR 89 CE1 11 1 Y 1 A TYR 89 ? CE2 ? A TYR 89 CE2 12 1 Y 1 A TYR 89 ? CZ ? A TYR 89 CZ 13 1 Y 1 A TYR 89 ? OH ? A TYR 89 OH 14 1 Y 1 B LYS 2 ? CG ? B LYS 2 CG 15 1 Y 1 B LYS 2 ? CD ? B LYS 2 CD 16 1 Y 1 B LYS 2 ? CE ? B LYS 2 CE 17 1 Y 1 B LYS 2 ? NZ ? B LYS 2 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1 ? A ALA 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A HIS 90 ? A HIS 90 5 1 Y 1 A LYS 91 ? A LYS 91 6 1 Y 1 A SER 92 ? A SER 92 7 1 Y 1 B SER 1 ? B SER 1 8 1 Y 1 B ASP 112 ? B ASP 112 9 1 Y 1 B PRO 113 ? B PRO 113 10 1 Y 1 B ARG 114 ? B ARG 114 11 1 Y 1 B PHE 115 ? B PHE 115 12 1 Y 1 B GLN 116 ? B GLN 116 13 1 Y 1 B ASP 117 ? B ASP 117 14 1 Y 1 B SER 118 ? B SER 118 15 1 Y 1 B SER 119 ? B SER 119 16 1 Y 1 B SER 120 ? B SER 120 17 1 Y 1 B SER 121 ? B SER 121 18 1 Y 1 B LYS 122 ? B LYS 122 19 1 Y 1 B ALA 123 ? B ALA 123 20 1 Y 1 B PRO 124 ? B PRO 124 21 1 Y 1 B PRO 125 ? B PRO 125 22 1 Y 1 B PRO 126 ? B PRO 126 23 1 Y 1 B SER 127 ? B SER 127 24 1 Y 1 B LEU 128 ? B LEU 128 25 1 Y 1 B PRO 129 ? B PRO 129 26 1 Y 1 B SER 130 ? B SER 130 27 1 Y 1 B PRO 131 ? B PRO 131 28 1 Y 1 B SER 132 ? B SER 132 29 1 Y 1 B ARG 133 ? B ARG 133 30 1 Y 1 B LEU 134 ? B LEU 134 31 1 Y 1 B PRO 135 ? B PRO 135 32 1 Y 1 B GLY 136 ? B GLY 136 33 1 Y 1 B PRO 137 ? B PRO 137 34 1 Y 1 B SER 138 ? B SER 138 35 1 Y 1 B ASP 139 ? B ASP 139 36 1 Y 1 B THR 140 ? B THR 140 37 1 Y 1 B PRO 141 ? B PRO 141 38 1 Y 1 B ILE 142 ? B ILE 142 39 1 Y 1 B LEU 143 ? B LEU 143 40 1 Y 1 B PRO 144 ? B PRO 144 41 1 Y 1 B GLN 145 ? B GLN 145 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero C 3 NAG 1 C NAG 1 A NAG 1 n C 3 NAG 2 C NAG 2 A NAG 2 n D 3 NAG 1 D NAG 1 A NAG 11 n D 3 NAG 2 D NAG 2 A NAG 12 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # _pdbx_entity_branch.entity_id 3 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 3 DGlcpNAcb1-4DGlcpNAcb1- 'Glycam Condensed Sequence' GMML 1.0 2 3 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS PDB2Glycan 1.1.0 3 3 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 3 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 NAG _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 NAG _pdbx_entity_branch_link.atom_id_2 O4 _pdbx_entity_branch_link.leaving_atom_id_2 HO4 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 3 NAG 1 n 3 NAG 2 n # _pdbx_entity_nonpoly.entity_id 4 _pdbx_entity_nonpoly.name 2-acetamido-2-deoxy-beta-D-glucopyranose _pdbx_entity_nonpoly.comp_id NAG #