data_1HVW # _entry.id 1HVW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1HVW pdb_00001hvw 10.2210/pdb1hvw/pdb RCSB RCSB012614 ? ? WWPDB D_1000012614 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1AXH _pdbx_database_related.details 'Native omega-atracotoxin-Hv1a' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HVW _pdbx_database_status.recvd_initial_deposition_date 2001-01-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Fletcher, J.I.' 1 'King, G.F.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Functional significance of the beta hairpin in the insecticidal neurotoxin omega-atracotoxin-Hv1a.' J.Biol.Chem. 276 26568 26576 2001 JBCHA3 US 0021-9258 0071 ? 11313356 10.1074/jbc.M102199200 1 'The Structure of a Novel Insecticidal Neurotoxin, Omega-Atracotoxin-HV1, from the Venom of an Australian Funnel Web Spider' Nat.Struct.Biol. 4 559 566 1997 NSBIEW US 1072-8368 2024 ? ? ? 2 'Structure-function Studies of Omega-atracotoxin, A Potent Antagonist of Insect Voltage-gated Calcium Channels' Eur.J.Biochem. 264 488 494 1999 EJBCAI IX 0014-2956 0262 ? ? 10.1046/j.1432-1327.1999.00646.x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tedford, H.W.' 1 ? primary 'Fletcher, J.I.' 2 ? primary 'King, G.F.' 3 ? 1 'Fletcher, J.I.' 4 ? 1 'Smith, R.' 5 ? 1 ;O'Donoghue, S.I. ; 6 ? 1 'Nilges, M.' 7 ? 1 'Connor, M.' 8 ? 1 'Howden, M.E.' 9 ? 1 'Christie, M.J.' 10 ? 1 'King, G.F.' 11 ? 2 'Wang, X.' 12 ? 2 'Smith, R.' 13 ? 2 'Fletcher, J.I.' 14 ? 2 'Wilson, H.' 15 ? 2 'Wood, C.J.' 16 ? 2 'Howden, M.E.' 17 ? 2 'King, G.F.' 18 ? # _cell.entry_id 1HVW _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1HVW _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description OMEGA-ATRACOTOXIN-HV1A _entity.formula_weight 2623.899 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name OMEGA-ACTX-HV1A # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code CIPSGQPCPYNENCCSQSCTGGRCD _entity_poly.pdbx_seq_one_letter_code_can CIPSGQPCPYNENCCSQSCTGGRCD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 ILE n 1 3 PRO n 1 4 SER n 1 5 GLY n 1 6 GLN n 1 7 PRO n 1 8 CYS n 1 9 PRO n 1 10 TYR n 1 11 ASN n 1 12 GLU n 1 13 ASN n 1 14 CYS n 1 15 CYS n 1 16 SER n 1 17 GLN n 1 18 SER n 1 19 CYS n 1 20 THR n 1 21 GLY n 1 22 GLY n 1 23 ARG n 1 24 CYS n 1 25 ASP n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details ;This peptide was chemically synthesized. The native peptide is naturally found in Hadronyche versuta (Blue mountain funnel-web spider).The mutant hairpinless toxin was synthesized by solid-phase peptide synthesis, oxidized/folded in a glutathione redox buffer, then purified using reverse-phase HPLC. ; # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TOT1A_HADVE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P56207 _struct_ref.pdbx_align_begin 4 _struct_ref.pdbx_seq_one_letter_code CIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1HVW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 25 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P56207 _struct_ref_seq.db_align_beg 4 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 37 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 25 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1HVW ? A ? ? UNP P56207 PHE 24 'SEE REMARK 999' ? 1 1 1HVW ? A ? ? UNP P56207 LYS 25 'SEE REMARK 999' ? 2 1 1HVW ? A ? ? UNP P56207 GLU 26 'SEE REMARK 999' ? 3 1 1HVW ? A ? ? UNP P56207 ASN 27 'SEE REMARK 999' ? 4 1 1HVW ? A ? ? UNP P56207 GLU 28 'SEE REMARK 999' ? 5 1 1HVW ? A ? ? UNP P56207 ASN 29 'SEE REMARK 999' ? 6 1 1HVW ? A ? ? UNP P56207 GLY 30 'SEE REMARK 999' ? 7 1 1HVW ? A ? ? UNP P56207 ASN 31 'SEE REMARK 999' ? 8 1 1HVW ? A ? ? UNP P56207 THR 32 'SEE REMARK 999' ? 9 1 1HVW ? A ? ? UNP P56207 VAL 33 'SEE REMARK 999' ? 10 1 1HVW GLY A 22 ? UNP P56207 LYS 34 'SEE REMARK 999' 22 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 2D_NOESY 2 1 1 2D_TOCSY 3 1 1 E-COSY 4 2 1 2D_NOESY 5 2 1 E-COSY 6 2 1 2D_TOCSY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.9 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.005 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '3 mM hairpinless peptide, 0.1 mM TSP, 25 micromolar chloramphenicol' '5% D2O, 95% H2O' 2 '3 mM hairpinless peptide, 0.1 mM TSP, 25 micromolar chloramphenicol' '100% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1HVW _pdbx_nmr_refine.method 'Torsion angle dynamics followed by dynamical simulated annealing' _pdbx_nmr_refine.details ;The structures are based on a total of 231 NOE-derived distance restraints, 19 dihedral-angle restraints, and 16 restraints defining 8 hydrogen bonds. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1HVW _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques.' # _pdbx_nmr_ensemble.entry_id 1HVW _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1HVW _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.0 'data analysis' Bruker 1 XEASY 1.3.13 'data analysis' 'Tae-he Xia and Christian Bartels' 2 DYANA 1.5 'structure solution' 'Peter Guntert, Christian Mumenthaler, and Torsten Herrman' 3 X-PLOR 3.1 refinement 'Axel Brunger' 4 # _exptl.entry_id 1HVW _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1HVW _struct.title 'HAIRPINLESS MUTANT OF OMEGA-ATRACOTOXIN-HV1A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1HVW _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'cystine knot, beta-hairpin, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 1 SG ? ? ? 1_555 A CYS 15 SG ? ? A CYS 1 A CYS 15 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf2 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 19 SG ? ? A CYS 8 A CYS 19 1_555 ? ? ? ? ? ? ? 2.022 ? ? disulf3 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 24 SG ? ? A CYS 14 A CYS 24 1_555 ? ? ? ? ? ? ? 2.021 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 19 ? THR A 20 ? CYS A 19 THR A 20 A 2 ARG A 23 ? CYS A 24 ? ARG A 23 CYS A 24 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id THR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 20 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id THR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 20 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ARG _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 23 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 23 # _database_PDB_matrix.entry_id 1HVW _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1HVW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 1 1 CYS CYS A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 ASP 25 25 25 ASP ASP A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-01-17 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 12 ? ? -173.48 35.24 2 1 ASN A 13 ? ? -149.62 30.32 3 2 GLU A 12 ? ? -169.71 33.27 4 2 ASN A 13 ? ? -150.25 29.79 5 3 GLU A 12 ? ? -163.30 30.14 6 4 GLU A 12 ? ? -168.12 32.80 7 4 ASN A 13 ? ? -143.88 30.68 8 5 GLU A 12 ? ? -171.61 34.50 9 5 ASN A 13 ? ? -145.74 29.94 10 6 GLU A 12 ? ? -145.05 29.08 11 6 SER A 18 ? ? -107.05 62.09 12 7 GLU A 12 ? ? -171.82 34.64 13 7 ASN A 13 ? ? -148.52 33.99 14 8 PRO A 9 ? ? -84.45 -74.25 15 8 ASN A 11 ? ? -92.36 49.15 16 8 GLU A 12 ? ? -154.77 31.81 17 8 SER A 18 ? ? -102.89 62.00 18 9 ASN A 11 ? ? -104.13 40.49 19 9 GLU A 12 ? ? -148.00 28.30 20 9 SER A 18 ? ? -108.72 61.76 21 10 PRO A 9 ? ? -84.86 -73.59 22 10 ASN A 11 ? ? -99.53 36.02 23 10 GLU A 12 ? ? -147.63 32.39 24 10 SER A 18 ? ? -110.06 62.19 25 11 PRO A 9 ? ? -84.35 -74.11 26 11 ASN A 11 ? ? -106.35 40.27 27 11 GLU A 12 ? ? -148.41 32.43 28 12 GLU A 12 ? ? -168.78 33.44 29 12 ASN A 13 ? ? -142.32 36.24 30 13 GLU A 12 ? ? -144.50 29.22 31 13 SER A 18 ? ? -107.62 60.34 32 14 PRO A 9 ? ? -84.49 -74.78 33 14 GLU A 12 ? ? -146.39 29.80 34 14 SER A 18 ? ? -109.65 62.04 35 15 PRO A 9 ? ? -84.59 -76.80 36 15 GLU A 12 ? ? -174.59 35.80 37 15 ASN A 13 ? ? -149.91 26.00 38 15 SER A 18 ? ? -105.20 61.93 39 16 PRO A 9 ? ? -84.59 -75.01 40 16 ASN A 11 ? ? -109.63 42.15 41 16 GLU A 12 ? ? -149.91 27.66 42 16 SER A 18 ? ? -109.22 61.56 43 17 PRO A 9 ? ? -84.04 -76.05 44 17 GLU A 12 ? ? -176.23 36.43 45 17 ASN A 13 ? ? -146.43 27.06 46 17 SER A 18 ? ? -107.29 60.11 47 18 ASN A 11 ? ? -98.43 41.90 48 18 GLU A 12 ? ? -155.31 30.27 49 18 SER A 18 ? ? -106.17 66.88 50 19 ASN A 11 ? ? -106.73 48.84 51 19 GLU A 12 ? ? -152.27 22.09 52 19 SER A 18 ? ? -101.69 61.42 53 20 PRO A 9 ? ? -84.74 -76.29 54 20 GLU A 12 ? ? -149.74 29.71 #