data_1HVW # _entry.id 1HVW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1HVW pdb_00001hvw 10.2210/pdb1hvw/pdb RCSB RCSB012614 ? ? WWPDB D_1000012614 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-01-17 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' pdbx_entry_details 8 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HVW _pdbx_database_status.recvd_initial_deposition_date 2001-01-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1AXH _pdbx_database_related.details 'Native omega-atracotoxin-Hv1a' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Fletcher, J.I.' 1 'King, G.F.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Functional significance of the beta hairpin in the insecticidal neurotoxin omega-atracotoxin-Hv1a.' J.Biol.Chem. 276 26568 26576 2001 JBCHA3 US 0021-9258 0071 ? 11313356 10.1074/jbc.M102199200 1 'The Structure of a Novel Insecticidal Neurotoxin, Omega-Atracotoxin-HV1, from the Venom of an Australian Funnel Web Spider' Nat.Struct.Biol. 4 559 566 1997 NSBIEW US 1072-8368 2024 ? ? ? 2 'Structure-function Studies of Omega-atracotoxin, A Potent Antagonist of Insect Voltage-gated Calcium Channels' Eur.J.Biochem. 264 488 494 1999 EJBCAI IX 0014-2956 0262 ? ? 10.1046/j.1432-1327.1999.00646.x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tedford, H.W.' 1 ? primary 'Fletcher, J.I.' 2 ? primary 'King, G.F.' 3 ? 1 'Fletcher, J.I.' 4 ? 1 'Smith, R.' 5 ? 1 ;O'Donoghue, S.I. ; 6 ? 1 'Nilges, M.' 7 ? 1 'Connor, M.' 8 ? 1 'Howden, M.E.' 9 ? 1 'Christie, M.J.' 10 ? 1 'King, G.F.' 11 ? 2 'Wang, X.' 12 ? 2 'Smith, R.' 13 ? 2 'Fletcher, J.I.' 14 ? 2 'Wilson, H.' 15 ? 2 'Wood, C.J.' 16 ? 2 'Howden, M.E.' 17 ? 2 'King, G.F.' 18 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description OMEGA-ATRACOTOXIN-HV1A _entity.formula_weight 2623.899 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name OMEGA-ACTX-HV1A # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code CIPSGQPCPYNENCCSQSCTGGRCD _entity_poly.pdbx_seq_one_letter_code_can CIPSGQPCPYNENCCSQSCTGGRCD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 ILE n 1 3 PRO n 1 4 SER n 1 5 GLY n 1 6 GLN n 1 7 PRO n 1 8 CYS n 1 9 PRO n 1 10 TYR n 1 11 ASN n 1 12 GLU n 1 13 ASN n 1 14 CYS n 1 15 CYS n 1 16 SER n 1 17 GLN n 1 18 SER n 1 19 CYS n 1 20 THR n 1 21 GLY n 1 22 GLY n 1 23 ARG n 1 24 CYS n 1 25 ASP n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details ;This peptide was chemically synthesized. The native peptide is naturally found in Hadronyche versuta (Blue mountain funnel-web spider).The mutant hairpinless toxin was synthesized by solid-phase peptide synthesis, oxidized/folded in a glutathione redox buffer, then purified using reverse-phase HPLC. ; # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 1 1 CYS CYS A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 ASP 25 25 25 ASP ASP A . n # _cell.entry_id 1HVW _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1HVW _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1HVW _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1HVW _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1HVW _struct.title 'HAIRPINLESS MUTANT OF OMEGA-ATRACOTOXIN-HV1A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1HVW _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'cystine knot, beta-hairpin, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TOT1A_HADVE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P56207 _struct_ref.pdbx_align_begin 4 _struct_ref.pdbx_seq_one_letter_code CIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1HVW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 25 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P56207 _struct_ref_seq.db_align_beg 4 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 37 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 25 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1HVW ? A ? ? UNP P56207 PHE 24 'SEE REMARK 999' ? 1 1 1HVW ? A ? ? UNP P56207 LYS 25 'SEE REMARK 999' ? 2 1 1HVW ? A ? ? UNP P56207 GLU 26 'SEE REMARK 999' ? 3 1 1HVW ? A ? ? UNP P56207 ASN 27 'SEE REMARK 999' ? 4 1 1HVW ? A ? ? UNP P56207 GLU 28 'SEE REMARK 999' ? 5 1 1HVW ? A ? ? UNP P56207 ASN 29 'SEE REMARK 999' ? 6 1 1HVW ? A ? ? UNP P56207 GLY 30 'SEE REMARK 999' ? 7 1 1HVW ? A ? ? UNP P56207 ASN 31 'SEE REMARK 999' ? 8 1 1HVW ? A ? ? UNP P56207 THR 32 'SEE REMARK 999' ? 9 1 1HVW ? A ? ? UNP P56207 VAL 33 'SEE REMARK 999' ? 10 1 1HVW GLY A 22 ? UNP P56207 LYS 34 'SEE REMARK 999' 22 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 1 SG ? ? ? 1_555 A CYS 15 SG ? ? A CYS 1 A CYS 15 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf2 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 19 SG ? ? A CYS 8 A CYS 19 1_555 ? ? ? ? ? ? ? 2.022 ? ? disulf3 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 24 SG ? ? A CYS 14 A CYS 24 1_555 ? ? ? ? ? ? ? 2.021 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 1 ? CYS A 15 ? CYS A 1 ? 1_555 CYS A 15 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 8 ? CYS A 19 ? CYS A 8 ? 1_555 CYS A 19 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 14 ? CYS A 24 ? CYS A 14 ? 1_555 CYS A 24 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 19 ? THR A 20 ? CYS A 19 THR A 20 A 2 ARG A 23 ? CYS A 24 ? ARG A 23 CYS A 24 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id THR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 20 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id THR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 20 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ARG _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 23 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 23 # _pdbx_entry_details.entry_id 1HVW _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 12 ? ? -173.48 35.24 2 1 ASN A 13 ? ? -149.62 30.32 3 2 GLU A 12 ? ? -169.71 33.27 4 2 ASN A 13 ? ? -150.25 29.79 5 3 GLU A 12 ? ? -163.30 30.14 6 4 GLU A 12 ? ? -168.12 32.80 7 4 ASN A 13 ? ? -143.88 30.68 8 5 GLU A 12 ? ? -171.61 34.50 9 5 ASN A 13 ? ? -145.74 29.94 10 6 GLU A 12 ? ? -145.05 29.08 11 6 SER A 18 ? ? -107.05 62.09 12 7 GLU A 12 ? ? -171.82 34.64 13 7 ASN A 13 ? ? -148.52 33.99 14 8 PRO A 9 ? ? -84.45 -74.25 15 8 ASN A 11 ? ? -92.36 49.15 16 8 GLU A 12 ? ? -154.77 31.81 17 8 SER A 18 ? ? -102.89 62.00 18 9 ASN A 11 ? ? -104.13 40.49 19 9 GLU A 12 ? ? -148.00 28.30 20 9 SER A 18 ? ? -108.72 61.76 21 10 PRO A 9 ? ? -84.86 -73.59 22 10 ASN A 11 ? ? -99.53 36.02 23 10 GLU A 12 ? ? -147.63 32.39 24 10 SER A 18 ? ? -110.06 62.19 25 11 PRO A 9 ? ? -84.35 -74.11 26 11 ASN A 11 ? ? -106.35 40.27 27 11 GLU A 12 ? ? -148.41 32.43 28 12 GLU A 12 ? ? -168.78 33.44 29 12 ASN A 13 ? ? -142.32 36.24 30 13 GLU A 12 ? ? -144.50 29.22 31 13 SER A 18 ? ? -107.62 60.34 32 14 PRO A 9 ? ? -84.49 -74.78 33 14 GLU A 12 ? ? -146.39 29.80 34 14 SER A 18 ? ? -109.65 62.04 35 15 PRO A 9 ? ? -84.59 -76.80 36 15 GLU A 12 ? ? -174.59 35.80 37 15 ASN A 13 ? ? -149.91 26.00 38 15 SER A 18 ? ? -105.20 61.93 39 16 PRO A 9 ? ? -84.59 -75.01 40 16 ASN A 11 ? ? -109.63 42.15 41 16 GLU A 12 ? ? -149.91 27.66 42 16 SER A 18 ? ? -109.22 61.56 43 17 PRO A 9 ? ? -84.04 -76.05 44 17 GLU A 12 ? ? -176.23 36.43 45 17 ASN A 13 ? ? -146.43 27.06 46 17 SER A 18 ? ? -107.29 60.11 47 18 ASN A 11 ? ? -98.43 41.90 48 18 GLU A 12 ? ? -155.31 30.27 49 18 SER A 18 ? ? -106.17 66.88 50 19 ASN A 11 ? ? -106.73 48.84 51 19 GLU A 12 ? ? -152.27 22.09 52 19 SER A 18 ? ? -101.69 61.42 53 20 PRO A 9 ? ? -84.74 -76.29 54 20 GLU A 12 ? ? -149.74 29.71 # _pdbx_nmr_ensemble.entry_id 1HVW _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1HVW _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '3 mM hairpinless peptide, 0.1 mM TSP, 25 micromolar chloramphenicol' '5% D2O, 95% H2O' 2 '3 mM hairpinless peptide, 0.1 mM TSP, 25 micromolar chloramphenicol' '100% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.9 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.005 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 2D_NOESY 2 1 1 2D_TOCSY 3 1 1 E-COSY 4 2 1 2D_NOESY 5 2 1 E-COSY 6 2 1 2D_TOCSY # _pdbx_nmr_details.entry_id 1HVW _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques.' # _pdbx_nmr_refine.entry_id 1HVW _pdbx_nmr_refine.method 'Torsion angle dynamics followed by dynamical simulated annealing' _pdbx_nmr_refine.details ;The structures are based on a total of 231 NOE-derived distance restraints, 19 dihedral-angle restraints, and 16 restraints defining 8 hydrogen bonds. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.0 'data analysis' Bruker 1 XEASY 1.3.13 'data analysis' 'Tae-he Xia and Christian Bartels' 2 DYANA 1.5 'structure solution' 'Peter Guntert, Christian Mumenthaler, and Torsten Herrman' 3 X-PLOR 3.1 refinement 'Axel Brunger' 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 CYS N N N N 61 CYS CA C N R 62 CYS C C N N 63 CYS O O N N 64 CYS CB C N N 65 CYS SG S N N 66 CYS OXT O N N 67 CYS H H N N 68 CYS H2 H N N 69 CYS HA H N N 70 CYS HB2 H N N 71 CYS HB3 H N N 72 CYS HG H N N 73 CYS HXT H N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 ILE N N N N 124 ILE CA C N S 125 ILE C C N N 126 ILE O O N N 127 ILE CB C N S 128 ILE CG1 C N N 129 ILE CG2 C N N 130 ILE CD1 C N N 131 ILE OXT O N N 132 ILE H H N N 133 ILE H2 H N N 134 ILE HA H N N 135 ILE HB H N N 136 ILE HG12 H N N 137 ILE HG13 H N N 138 ILE HG21 H N N 139 ILE HG22 H N N 140 ILE HG23 H N N 141 ILE HD11 H N N 142 ILE HD12 H N N 143 ILE HD13 H N N 144 ILE HXT H N N 145 LYS N N N N 146 LYS CA C N S 147 LYS C C N N 148 LYS O O N N 149 LYS CB C N N 150 LYS CG C N N 151 LYS CD C N N 152 LYS CE C N N 153 LYS NZ N N N 154 LYS OXT O N N 155 LYS H H N N 156 LYS H2 H N N 157 LYS HA H N N 158 LYS HB2 H N N 159 LYS HB3 H N N 160 LYS HG2 H N N 161 LYS HG3 H N N 162 LYS HD2 H N N 163 LYS HD3 H N N 164 LYS HE2 H N N 165 LYS HE3 H N N 166 LYS HZ1 H N N 167 LYS HZ2 H N N 168 LYS HZ3 H N N 169 LYS HXT H N N 170 PHE N N N N 171 PHE CA C N S 172 PHE C C N N 173 PHE O O N N 174 PHE CB C N N 175 PHE CG C Y N 176 PHE CD1 C Y N 177 PHE CD2 C Y N 178 PHE CE1 C Y N 179 PHE CE2 C Y N 180 PHE CZ C Y N 181 PHE OXT O N N 182 PHE H H N N 183 PHE H2 H N N 184 PHE HA H N N 185 PHE HB2 H N N 186 PHE HB3 H N N 187 PHE HD1 H N N 188 PHE HD2 H N N 189 PHE HE1 H N N 190 PHE HE2 H N N 191 PHE HZ H N N 192 PHE HXT H N N 193 PRO N N N N 194 PRO CA C N S 195 PRO C C N N 196 PRO O O N N 197 PRO CB C N N 198 PRO CG C N N 199 PRO CD C N N 200 PRO OXT O N N 201 PRO H H N N 202 PRO HA H N N 203 PRO HB2 H N N 204 PRO HB3 H N N 205 PRO HG2 H N N 206 PRO HG3 H N N 207 PRO HD2 H N N 208 PRO HD3 H N N 209 PRO HXT H N N 210 SER N N N N 211 SER CA C N S 212 SER C C N N 213 SER O O N N 214 SER CB C N N 215 SER OG O N N 216 SER OXT O N N 217 SER H H N N 218 SER H2 H N N 219 SER HA H N N 220 SER HB2 H N N 221 SER HB3 H N N 222 SER HG H N N 223 SER HXT H N N 224 THR N N N N 225 THR CA C N S 226 THR C C N N 227 THR O O N N 228 THR CB C N R 229 THR OG1 O N N 230 THR CG2 C N N 231 THR OXT O N N 232 THR H H N N 233 THR H2 H N N 234 THR HA H N N 235 THR HB H N N 236 THR HG1 H N N 237 THR HG21 H N N 238 THR HG22 H N N 239 THR HG23 H N N 240 THR HXT H N N 241 TYR N N N N 242 TYR CA C N S 243 TYR C C N N 244 TYR O O N N 245 TYR CB C N N 246 TYR CG C Y N 247 TYR CD1 C Y N 248 TYR CD2 C Y N 249 TYR CE1 C Y N 250 TYR CE2 C Y N 251 TYR CZ C Y N 252 TYR OH O N N 253 TYR OXT O N N 254 TYR H H N N 255 TYR H2 H N N 256 TYR HA H N N 257 TYR HB2 H N N 258 TYR HB3 H N N 259 TYR HD1 H N N 260 TYR HD2 H N N 261 TYR HE1 H N N 262 TYR HE2 H N N 263 TYR HH H N N 264 TYR HXT H N N 265 VAL N N N N 266 VAL CA C N S 267 VAL C C N N 268 VAL O O N N 269 VAL CB C N N 270 VAL CG1 C N N 271 VAL CG2 C N N 272 VAL OXT O N N 273 VAL H H N N 274 VAL H2 H N N 275 VAL HA H N N 276 VAL HB H N N 277 VAL HG11 H N N 278 VAL HG12 H N N 279 VAL HG13 H N N 280 VAL HG21 H N N 281 VAL HG22 H N N 282 VAL HG23 H N N 283 VAL HXT H N N 284 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 CYS N CA sing N N 58 CYS N H sing N N 59 CYS N H2 sing N N 60 CYS CA C sing N N 61 CYS CA CB sing N N 62 CYS CA HA sing N N 63 CYS C O doub N N 64 CYS C OXT sing N N 65 CYS CB SG sing N N 66 CYS CB HB2 sing N N 67 CYS CB HB3 sing N N 68 CYS SG HG sing N N 69 CYS OXT HXT sing N N 70 GLN N CA sing N N 71 GLN N H sing N N 72 GLN N H2 sing N N 73 GLN CA C sing N N 74 GLN CA CB sing N N 75 GLN CA HA sing N N 76 GLN C O doub N N 77 GLN C OXT sing N N 78 GLN CB CG sing N N 79 GLN CB HB2 sing N N 80 GLN CB HB3 sing N N 81 GLN CG CD sing N N 82 GLN CG HG2 sing N N 83 GLN CG HG3 sing N N 84 GLN CD OE1 doub N N 85 GLN CD NE2 sing N N 86 GLN NE2 HE21 sing N N 87 GLN NE2 HE22 sing N N 88 GLN OXT HXT sing N N 89 GLU N CA sing N N 90 GLU N H sing N N 91 GLU N H2 sing N N 92 GLU CA C sing N N 93 GLU CA CB sing N N 94 GLU CA HA sing N N 95 GLU C O doub N N 96 GLU C OXT sing N N 97 GLU CB CG sing N N 98 GLU CB HB2 sing N N 99 GLU CB HB3 sing N N 100 GLU CG CD sing N N 101 GLU CG HG2 sing N N 102 GLU CG HG3 sing N N 103 GLU CD OE1 doub N N 104 GLU CD OE2 sing N N 105 GLU OE2 HE2 sing N N 106 GLU OXT HXT sing N N 107 GLY N CA sing N N 108 GLY N H sing N N 109 GLY N H2 sing N N 110 GLY CA C sing N N 111 GLY CA HA2 sing N N 112 GLY CA HA3 sing N N 113 GLY C O doub N N 114 GLY C OXT sing N N 115 GLY OXT HXT sing N N 116 ILE N CA sing N N 117 ILE N H sing N N 118 ILE N H2 sing N N 119 ILE CA C sing N N 120 ILE CA CB sing N N 121 ILE CA HA sing N N 122 ILE C O doub N N 123 ILE C OXT sing N N 124 ILE CB CG1 sing N N 125 ILE CB CG2 sing N N 126 ILE CB HB sing N N 127 ILE CG1 CD1 sing N N 128 ILE CG1 HG12 sing N N 129 ILE CG1 HG13 sing N N 130 ILE CG2 HG21 sing N N 131 ILE CG2 HG22 sing N N 132 ILE CG2 HG23 sing N N 133 ILE CD1 HD11 sing N N 134 ILE CD1 HD12 sing N N 135 ILE CD1 HD13 sing N N 136 ILE OXT HXT sing N N 137 LYS N CA sing N N 138 LYS N H sing N N 139 LYS N H2 sing N N 140 LYS CA C sing N N 141 LYS CA CB sing N N 142 LYS CA HA sing N N 143 LYS C O doub N N 144 LYS C OXT sing N N 145 LYS CB CG sing N N 146 LYS CB HB2 sing N N 147 LYS CB HB3 sing N N 148 LYS CG CD sing N N 149 LYS CG HG2 sing N N 150 LYS CG HG3 sing N N 151 LYS CD CE sing N N 152 LYS CD HD2 sing N N 153 LYS CD HD3 sing N N 154 LYS CE NZ sing N N 155 LYS CE HE2 sing N N 156 LYS CE HE3 sing N N 157 LYS NZ HZ1 sing N N 158 LYS NZ HZ2 sing N N 159 LYS NZ HZ3 sing N N 160 LYS OXT HXT sing N N 161 PHE N CA sing N N 162 PHE N H sing N N 163 PHE N H2 sing N N 164 PHE CA C sing N N 165 PHE CA CB sing N N 166 PHE CA HA sing N N 167 PHE C O doub N N 168 PHE C OXT sing N N 169 PHE CB CG sing N N 170 PHE CB HB2 sing N N 171 PHE CB HB3 sing N N 172 PHE CG CD1 doub Y N 173 PHE CG CD2 sing Y N 174 PHE CD1 CE1 sing Y N 175 PHE CD1 HD1 sing N N 176 PHE CD2 CE2 doub Y N 177 PHE CD2 HD2 sing N N 178 PHE CE1 CZ doub Y N 179 PHE CE1 HE1 sing N N 180 PHE CE2 CZ sing Y N 181 PHE CE2 HE2 sing N N 182 PHE CZ HZ sing N N 183 PHE OXT HXT sing N N 184 PRO N CA sing N N 185 PRO N CD sing N N 186 PRO N H sing N N 187 PRO CA C sing N N 188 PRO CA CB sing N N 189 PRO CA HA sing N N 190 PRO C O doub N N 191 PRO C OXT sing N N 192 PRO CB CG sing N N 193 PRO CB HB2 sing N N 194 PRO CB HB3 sing N N 195 PRO CG CD sing N N 196 PRO CG HG2 sing N N 197 PRO CG HG3 sing N N 198 PRO CD HD2 sing N N 199 PRO CD HD3 sing N N 200 PRO OXT HXT sing N N 201 SER N CA sing N N 202 SER N H sing N N 203 SER N H2 sing N N 204 SER CA C sing N N 205 SER CA CB sing N N 206 SER CA HA sing N N 207 SER C O doub N N 208 SER C OXT sing N N 209 SER CB OG sing N N 210 SER CB HB2 sing N N 211 SER CB HB3 sing N N 212 SER OG HG sing N N 213 SER OXT HXT sing N N 214 THR N CA sing N N 215 THR N H sing N N 216 THR N H2 sing N N 217 THR CA C sing N N 218 THR CA CB sing N N 219 THR CA HA sing N N 220 THR C O doub N N 221 THR C OXT sing N N 222 THR CB OG1 sing N N 223 THR CB CG2 sing N N 224 THR CB HB sing N N 225 THR OG1 HG1 sing N N 226 THR CG2 HG21 sing N N 227 THR CG2 HG22 sing N N 228 THR CG2 HG23 sing N N 229 THR OXT HXT sing N N 230 TYR N CA sing N N 231 TYR N H sing N N 232 TYR N H2 sing N N 233 TYR CA C sing N N 234 TYR CA CB sing N N 235 TYR CA HA sing N N 236 TYR C O doub N N 237 TYR C OXT sing N N 238 TYR CB CG sing N N 239 TYR CB HB2 sing N N 240 TYR CB HB3 sing N N 241 TYR CG CD1 doub Y N 242 TYR CG CD2 sing Y N 243 TYR CD1 CE1 sing Y N 244 TYR CD1 HD1 sing N N 245 TYR CD2 CE2 doub Y N 246 TYR CD2 HD2 sing N N 247 TYR CE1 CZ doub Y N 248 TYR CE1 HE1 sing N N 249 TYR CE2 CZ sing Y N 250 TYR CE2 HE2 sing N N 251 TYR CZ OH sing N N 252 TYR OH HH sing N N 253 TYR OXT HXT sing N N 254 VAL N CA sing N N 255 VAL N H sing N N 256 VAL N H2 sing N N 257 VAL CA C sing N N 258 VAL CA CB sing N N 259 VAL CA HA sing N N 260 VAL C O doub N N 261 VAL C OXT sing N N 262 VAL CB CG1 sing N N 263 VAL CB CG2 sing N N 264 VAL CB HB sing N N 265 VAL CG1 HG11 sing N N 266 VAL CG1 HG12 sing N N 267 VAL CG1 HG13 sing N N 268 VAL CG2 HG21 sing N N 269 VAL CG2 HG22 sing N N 270 VAL CG2 HG23 sing N N 271 VAL OXT HXT sing N N 272 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1HVW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_