data_1HXV # _entry.id 1HXV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1HXV pdb_00001hxv 10.2210/pdb1hxv/pdb RCSB RCSB012669 ? ? WWPDB D_1000012669 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-05-29 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HXV _pdbx_database_status.recvd_initial_deposition_date 2001-01-17 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 4953 _pdbx_database_related.details '4953 is the BMRB entry corresponding to the NMR data for this protein' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Vogtherr, M.' 1 'Parac, T.N.' 2 'Maurer, M.' 3 'Pahl, A.' 4 'Fiebig, K.' 5 # _citation.id primary _citation.title ;NMR solution structure and dynamics of the peptidyl-prolyl cis-trans isomerase domain of the trigger factor from Mycoplasma genitalium compared to FK506-binding protein. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 318 _citation.page_first 1097 _citation.page_last 1115 _citation.year 2002 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12054805 _citation.pdbx_database_id_DOI '10.1016/S0022-2836(02)00112-2' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Vogtherr, M.' 1 ? primary 'Jacobs, D.M.' 2 ? primary 'Parac, T.N.' 3 ? primary 'Maurer, M.' 4 ? primary 'Pahl, A.' 5 ? primary 'Saxena, K.' 6 ? primary 'Ruterjans, H.' 7 ? primary 'Griesinger, C.' 8 ? primary 'Fiebig, K.M.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TRIGGER FACTOR' _entity.formula_weight 12456.365 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'PPIASE DOMAIN (RESIDUES 150-250)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRGSHHHHHHGSEKLAKTKSTMVDVSDKKLANGDIAIIDFTGIVDNKKLASASAQNYELTIGSNSFIKGFETGLIAMKVN QKKTLALTFPSDYHVKELQSKPVTFEVVLKAIK ; _entity_poly.pdbx_seq_one_letter_code_can ;MRGSHHHHHHGSEKLAKTKSTMVDVSDKKLANGDIAIIDFTGIVDNKKLASASAQNYELTIGSNSFIKGFETGLIAMKVN QKKTLALTFPSDYHVKELQSKPVTFEVVLKAIK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 GLY n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 GLY n 1 12 SER n 1 13 GLU n 1 14 LYS n 1 15 LEU n 1 16 ALA n 1 17 LYS n 1 18 THR n 1 19 LYS n 1 20 SER n 1 21 THR n 1 22 MET n 1 23 VAL n 1 24 ASP n 1 25 VAL n 1 26 SER n 1 27 ASP n 1 28 LYS n 1 29 LYS n 1 30 LEU n 1 31 ALA n 1 32 ASN n 1 33 GLY n 1 34 ASP n 1 35 ILE n 1 36 ALA n 1 37 ILE n 1 38 ILE n 1 39 ASP n 1 40 PHE n 1 41 THR n 1 42 GLY n 1 43 ILE n 1 44 VAL n 1 45 ASP n 1 46 ASN n 1 47 LYS n 1 48 LYS n 1 49 LEU n 1 50 ALA n 1 51 SER n 1 52 ALA n 1 53 SER n 1 54 ALA n 1 55 GLN n 1 56 ASN n 1 57 TYR n 1 58 GLU n 1 59 LEU n 1 60 THR n 1 61 ILE n 1 62 GLY n 1 63 SER n 1 64 ASN n 1 65 SER n 1 66 PHE n 1 67 ILE n 1 68 LYS n 1 69 GLY n 1 70 PHE n 1 71 GLU n 1 72 THR n 1 73 GLY n 1 74 LEU n 1 75 ILE n 1 76 ALA n 1 77 MET n 1 78 LYS n 1 79 VAL n 1 80 ASN n 1 81 GLN n 1 82 LYS n 1 83 LYS n 1 84 THR n 1 85 LEU n 1 86 ALA n 1 87 LEU n 1 88 THR n 1 89 PHE n 1 90 PRO n 1 91 SER n 1 92 ASP n 1 93 TYR n 1 94 HIS n 1 95 VAL n 1 96 LYS n 1 97 GLU n 1 98 LEU n 1 99 GLN n 1 100 SER n 1 101 LYS n 1 102 PRO n 1 103 VAL n 1 104 THR n 1 105 PHE n 1 106 GLU n 1 107 VAL n 1 108 VAL n 1 109 LEU n 1 110 LYS n 1 111 ALA n 1 112 ILE n 1 113 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Mycoplasma _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycoplasma genitalium' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2097 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PQE30 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ARG 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 HIS 8 8 ? ? ? A . n A 1 9 HIS 9 9 ? ? ? A . n A 1 10 HIS 10 10 ? ? ? A . n A 1 11 GLY 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 GLU 13 13 ? ? ? A . n A 1 14 LYS 14 14 ? ? ? A . n A 1 15 LEU 15 15 ? ? ? A . n A 1 16 ALA 16 16 ? ? ? A . n A 1 17 LYS 17 17 ? ? ? A . n A 1 18 THR 18 18 ? ? ? A . n A 1 19 LYS 19 19 ? ? ? A . n A 1 20 SER 20 20 ? ? ? A . n A 1 21 THR 21 21 ? ? ? A . n A 1 22 MET 22 22 ? ? ? A . n A 1 23 VAL 23 23 ? ? ? A . n A 1 24 ASP 24 24 ? ? ? A . n A 1 25 VAL 25 25 ? ? ? A . n A 1 26 SER 26 26 ? ? ? A . n A 1 27 ASP 27 27 ? ? ? A . n A 1 28 LYS 28 28 ? ? ? A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 LYS 113 113 113 LYS LYS A . n # _exptl.entry_id 1HXV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1HXV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1HXV _struct.title 'PPIASE DOMAIN OF THE MYCOPLASMA GENITALIUM TRIGGER FACTOR' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1HXV _struct_keywords.pdbx_keywords CHAPERONE _struct_keywords.text 'FKBP fold, PPIase, CHAPERONE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TIG_MYCGE _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EKLAKTKSTMVDVSDKKLANGDIAIIDFTGIVDNKKLASASAQNYELTIGSNSFIKGFETGLIAMKVNQKKTLALTFPSD YHVKELQSKPVTFEVVLKAIK ; _struct_ref.pdbx_align_begin 150 _struct_ref.pdbx_db_accession P47480 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1HXV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 13 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 113 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P47480 _struct_ref_seq.db_align_beg 150 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 250 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 13 _struct_ref_seq.pdbx_auth_seq_align_end 113 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1hxv MET A 1 ? UNP P47480 ? ? 'expression tag' 1 1 1 1hxv ARG A 2 ? UNP P47480 ? ? 'expression tag' 2 2 1 1hxv GLY A 3 ? UNP P47480 ? ? 'expression tag' 3 3 1 1hxv SER A 4 ? UNP P47480 ? ? 'expression tag' 4 4 1 1hxv HIS A 5 ? UNP P47480 ? ? 'expression tag' 5 5 1 1hxv HIS A 6 ? UNP P47480 ? ? 'expression tag' 6 6 1 1hxv HIS A 7 ? UNP P47480 ? ? 'expression tag' 7 7 1 1hxv HIS A 8 ? UNP P47480 ? ? 'expression tag' 8 8 1 1hxv HIS A 9 ? UNP P47480 ? ? 'expression tag' 9 9 1 1hxv HIS A 10 ? UNP P47480 ? ? 'expression tag' 10 10 1 1hxv GLY A 11 ? UNP P47480 ? ? 'expression tag' 11 11 1 1hxv SER A 12 ? UNP P47480 ? ? 'expression tag' 12 12 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 69 ? ALA A 76 ? GLY A 69 ALA A 76 1 ? 8 HELX_P HELX_P2 2 LYS A 96 ? SER A 100 ? LYS A 96 SER A 100 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 81 ? LEU A 85 ? GLN A 81 LEU A 85 A 2 THR A 104 ? LEU A 109 ? THR A 104 LEU A 109 A 3 ASP A 34 ? VAL A 44 ? ASP A 34 VAL A 44 A 4 LYS A 47 ? LYS A 48 ? LYS A 47 LYS A 48 B 1 GLN A 81 ? LEU A 85 ? GLN A 81 LEU A 85 B 2 THR A 104 ? LEU A 109 ? THR A 104 LEU A 109 B 3 ASP A 34 ? VAL A 44 ? ASP A 34 VAL A 44 B 4 ASN A 56 ? ILE A 61 ? ASN A 56 ILE A 61 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 85 ? O LEU A 85 N PHE A 105 ? N PHE A 105 A 2 3 N VAL A 108 ? N VAL A 108 O ASP A 39 ? O ASP A 39 A 3 4 N VAL A 44 ? N VAL A 44 O LYS A 47 ? O LYS A 47 B 1 2 O LEU A 85 ? O LEU A 85 N PHE A 105 ? N PHE A 105 B 2 3 N VAL A 108 ? N VAL A 108 O ASP A 39 ? O ASP A 39 B 3 4 N ILE A 38 ? N ILE A 38 O TYR A 57 ? O TYR A 57 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A PHE 40 ? ? H A ALA 54 ? ? 1.60 2 2 O A ILE 43 ? ? H A THR 104 ? ? 1.60 3 3 O A ILE 43 ? ? H A THR 104 ? ? 1.56 4 4 O A ILE 43 ? ? H A THR 104 ? ? 1.60 5 8 O A PHE 40 ? ? H A ALA 54 ? ? 1.59 6 10 O A ILE 43 ? ? H A THR 104 ? ? 1.59 7 10 O A PHE 40 ? ? H A ALA 54 ? ? 1.59 8 11 O A PHE 40 ? ? H A ALA 54 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 32 ? ? -49.17 -175.76 2 1 ASP A 45 ? ? 53.27 76.18 3 1 ASN A 46 ? ? 85.18 -41.05 4 1 GLN A 55 ? ? -90.74 -137.87 5 1 ASN A 56 ? ? -59.44 75.60 6 1 GLU A 58 ? ? -65.98 86.27 7 1 PHE A 70 ? ? -80.97 -78.45 8 1 LYS A 78 ? ? -75.38 -157.74 9 1 LEU A 98 ? ? -79.97 27.32 10 1 SER A 100 ? ? -141.30 58.07 11 1 LEU A 109 ? ? -51.25 76.13 12 2 ALA A 31 ? ? -78.99 -168.44 13 2 ASN A 32 ? ? -49.26 -174.76 14 2 ASP A 45 ? ? 55.07 75.18 15 2 ASN A 46 ? ? 86.25 -34.95 16 2 SER A 51 ? ? -52.17 -80.76 17 2 GLN A 55 ? ? -91.43 -137.55 18 2 ASN A 56 ? ? -59.36 76.25 19 2 GLU A 58 ? ? -65.76 85.26 20 2 PHE A 70 ? ? -79.24 -79.89 21 2 LYS A 78 ? ? -72.16 -162.90 22 2 LEU A 98 ? ? -79.85 28.82 23 2 SER A 100 ? ? -141.35 56.52 24 2 LEU A 109 ? ? -50.14 76.43 25 3 ASN A 32 ? ? -48.96 -174.23 26 3 ASP A 45 ? ? 52.94 78.32 27 3 ASN A 46 ? ? 85.70 -39.56 28 3 SER A 51 ? ? -52.50 -80.95 29 3 GLN A 55 ? ? -90.28 -135.22 30 3 ASN A 56 ? ? -59.51 77.08 31 3 GLU A 58 ? ? -60.14 88.57 32 3 PHE A 70 ? ? -81.89 -75.93 33 3 LYS A 78 ? ? -73.48 -157.40 34 3 SER A 100 ? ? -141.22 54.91 35 3 LEU A 109 ? ? -51.64 71.48 36 4 ALA A 31 ? ? -79.65 -169.21 37 4 ASN A 32 ? ? -49.75 -173.55 38 4 ASP A 45 ? ? 54.58 76.49 39 4 ASN A 46 ? ? 86.56 -35.41 40 4 SER A 51 ? ? -50.10 -80.16 41 4 GLN A 55 ? ? -93.55 -136.13 42 4 ASN A 56 ? ? -59.57 76.01 43 4 GLU A 58 ? ? -65.72 83.80 44 4 PHE A 70 ? ? -80.40 -71.37 45 4 LYS A 78 ? ? -73.85 -164.97 46 4 LEU A 98 ? ? -79.75 26.25 47 4 LEU A 109 ? ? -47.66 76.69 48 5 ALA A 31 ? ? -79.87 -164.21 49 5 ASN A 32 ? ? -51.24 -171.43 50 5 ASP A 45 ? ? 53.71 77.26 51 5 ASN A 46 ? ? 88.06 -34.32 52 5 SER A 51 ? ? -47.10 -80.93 53 5 GLN A 55 ? ? -93.44 -134.70 54 5 ASN A 56 ? ? -59.72 75.60 55 5 GLU A 58 ? ? -60.67 87.50 56 5 PHE A 70 ? ? -79.09 -75.30 57 5 LYS A 78 ? ? -78.74 -156.90 58 5 LEU A 98 ? ? -79.55 28.31 59 5 SER A 100 ? ? -141.31 57.37 60 5 LEU A 109 ? ? -50.00 76.82 61 6 ASN A 32 ? ? -49.45 -174.97 62 6 ASP A 45 ? ? 54.27 77.13 63 6 ASN A 46 ? ? 84.52 -32.47 64 6 SER A 51 ? ? -47.58 -79.26 65 6 GLN A 55 ? ? -89.53 -142.71 66 6 ASN A 56 ? ? -59.59 80.39 67 6 GLU A 58 ? ? -60.15 87.54 68 6 PHE A 70 ? ? -75.62 -74.81 69 6 LYS A 78 ? ? -78.06 -158.96 70 6 PRO A 102 ? ? -69.54 91.53 71 6 LEU A 109 ? ? -49.16 72.58 72 7 ALA A 31 ? ? -78.70 -169.10 73 7 ASN A 32 ? ? -49.36 -174.41 74 7 ASP A 45 ? ? 55.16 76.55 75 7 ASN A 46 ? ? 83.77 -34.74 76 7 SER A 51 ? ? -55.30 -78.75 77 7 GLN A 55 ? ? -90.94 -134.63 78 7 ASN A 56 ? ? -59.62 73.30 79 7 PHE A 70 ? ? -78.91 -71.82 80 7 LYS A 78 ? ? -78.25 -163.41 81 7 SER A 100 ? ? -141.08 59.41 82 7 LEU A 109 ? ? -48.84 77.62 83 8 ALA A 31 ? ? -79.78 -169.54 84 8 ASN A 32 ? ? -48.19 -177.95 85 8 ASP A 45 ? ? 54.79 77.86 86 8 ASN A 46 ? ? 83.73 -31.70 87 8 SER A 51 ? ? -49.92 -79.51 88 8 GLN A 55 ? ? -91.71 -139.25 89 8 ASN A 56 ? ? -59.22 76.00 90 8 PHE A 70 ? ? -81.24 -81.35 91 8 LYS A 78 ? ? -70.96 -158.65 92 8 SER A 100 ? ? -141.32 56.31 93 8 LEU A 109 ? ? -54.35 74.65 94 9 ASN A 32 ? ? -50.10 -173.57 95 9 ASP A 45 ? ? 52.79 78.76 96 9 ASN A 46 ? ? 85.80 -43.66 97 9 GLN A 55 ? ? -90.97 -134.18 98 9 ASN A 56 ? ? -60.70 73.46 99 9 GLU A 58 ? ? -59.97 88.87 100 9 ASN A 64 ? ? 43.93 29.55 101 9 PHE A 70 ? ? -81.90 -82.11 102 9 LYS A 78 ? ? -78.47 -163.97 103 9 LEU A 98 ? ? -79.56 28.24 104 9 SER A 100 ? ? -141.18 57.57 105 9 LEU A 109 ? ? -43.25 78.68 106 10 ASN A 32 ? ? -47.61 -176.29 107 10 ASP A 45 ? ? 54.98 74.56 108 10 ASN A 46 ? ? 88.56 -32.80 109 10 SER A 51 ? ? -46.85 -82.12 110 10 GLN A 55 ? ? -90.84 -137.43 111 10 ASN A 56 ? ? -59.57 74.56 112 10 GLU A 58 ? ? -69.33 87.98 113 10 PHE A 70 ? ? -75.50 -73.43 114 10 LYS A 78 ? ? -76.24 -165.13 115 10 SER A 100 ? ? -141.44 57.26 116 10 LEU A 109 ? ? -49.80 75.82 117 11 ASN A 32 ? ? -46.86 -177.57 118 11 ASP A 45 ? ? 54.35 76.11 119 11 ASN A 46 ? ? 88.42 -35.25 120 11 SER A 51 ? ? -46.54 -80.57 121 11 GLN A 55 ? ? -91.66 -135.04 122 11 ASN A 56 ? ? -60.23 75.18 123 11 GLU A 58 ? ? -59.76 86.73 124 11 PHE A 70 ? ? -81.68 -76.21 125 11 LYS A 78 ? ? -68.86 -162.35 126 11 LEU A 109 ? ? -48.29 77.72 127 12 ASN A 32 ? ? -49.76 -172.24 128 12 ASP A 45 ? ? 54.30 76.33 129 12 ASN A 46 ? ? 87.37 -34.99 130 12 SER A 51 ? ? -48.32 -78.15 131 12 GLN A 55 ? ? -90.86 -133.80 132 12 ASN A 56 ? ? -60.73 74.28 133 12 GLU A 58 ? ? -65.94 85.36 134 12 PHE A 70 ? ? -78.74 -72.31 135 12 LYS A 78 ? ? -75.53 -155.56 136 12 LEU A 98 ? ? -78.77 27.55 137 12 SER A 100 ? ? -141.38 53.08 138 12 LEU A 109 ? ? -49.72 76.60 # _pdbx_nmr_ensemble.entry_id 1HXV _pdbx_nmr_ensemble.conformers_calculated_total_number 160 _pdbx_nmr_ensemble.conformers_submitted_total_number 12 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1HXV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '2 mM U-15N' ;90% H2O, 10% D2O 50 mM sodium phosphate pH 6.5 ; 2 '2 mM U-15N U-13C' ;100% D2O 50 mM sodium phosphate pH 6.5 ; 3 '2 mM unlabeled' ;100% D2O 50 mM sodium phosphate pH 6.5 ; # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure atmospheric _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50 mM sodium phosphate' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 HNHA 3 2 1 3D_13C-separated_NOESY 4 3 1 '2D NOESY' # _pdbx_nmr_details.entry_id 1HXV _pdbx_nmr_details.text ;partially aligned samples: 4 % C12E5/n-hexanol, ratio=0.96 (Rueckert and Otting, JACS 122, 7793-7797 (2000)) ; # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection 'Bruker Analytik' 1 XwinNMR 2.6 processing 'Bruker Analytik' 2 XEASY 1.3.14 'data analysis' Bartels 3 CNS 1.0 'structure solution' Brunger 4 DipoCoup 1.0 'structure solution' Meiler 5 DipoCoup 1.0 refinement Meiler 6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ARG 2 ? A ARG 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A HIS 8 ? A HIS 8 9 1 Y 1 A HIS 9 ? A HIS 9 10 1 Y 1 A HIS 10 ? A HIS 10 11 1 Y 1 A GLY 11 ? A GLY 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A GLU 13 ? A GLU 13 14 1 Y 1 A LYS 14 ? A LYS 14 15 1 Y 1 A LEU 15 ? A LEU 15 16 1 Y 1 A ALA 16 ? A ALA 16 17 1 Y 1 A LYS 17 ? A LYS 17 18 1 Y 1 A THR 18 ? A THR 18 19 1 Y 1 A LYS 19 ? A LYS 19 20 1 Y 1 A SER 20 ? A SER 20 21 1 Y 1 A THR 21 ? A THR 21 22 1 Y 1 A MET 22 ? A MET 22 23 1 Y 1 A VAL 23 ? A VAL 23 24 1 Y 1 A ASP 24 ? A ASP 24 25 1 Y 1 A VAL 25 ? A VAL 25 26 1 Y 1 A SER 26 ? A SER 26 27 1 Y 1 A ASP 27 ? A ASP 27 28 1 Y 1 A LYS 28 ? A LYS 28 29 2 Y 1 A MET 1 ? A MET 1 30 2 Y 1 A ARG 2 ? A ARG 2 31 2 Y 1 A GLY 3 ? A GLY 3 32 2 Y 1 A SER 4 ? A SER 4 33 2 Y 1 A HIS 5 ? A HIS 5 34 2 Y 1 A HIS 6 ? A HIS 6 35 2 Y 1 A HIS 7 ? A HIS 7 36 2 Y 1 A HIS 8 ? A HIS 8 37 2 Y 1 A HIS 9 ? A HIS 9 38 2 Y 1 A HIS 10 ? A HIS 10 39 2 Y 1 A GLY 11 ? A GLY 11 40 2 Y 1 A SER 12 ? A SER 12 41 2 Y 1 A GLU 13 ? A GLU 13 42 2 Y 1 A LYS 14 ? A LYS 14 43 2 Y 1 A LEU 15 ? A LEU 15 44 2 Y 1 A ALA 16 ? A ALA 16 45 2 Y 1 A LYS 17 ? A LYS 17 46 2 Y 1 A THR 18 ? A THR 18 47 2 Y 1 A LYS 19 ? A LYS 19 48 2 Y 1 A SER 20 ? A SER 20 49 2 Y 1 A THR 21 ? A THR 21 50 2 Y 1 A MET 22 ? A MET 22 51 2 Y 1 A VAL 23 ? A VAL 23 52 2 Y 1 A ASP 24 ? A ASP 24 53 2 Y 1 A VAL 25 ? A VAL 25 54 2 Y 1 A SER 26 ? A SER 26 55 2 Y 1 A ASP 27 ? A ASP 27 56 2 Y 1 A LYS 28 ? A LYS 28 57 3 Y 1 A MET 1 ? A MET 1 58 3 Y 1 A ARG 2 ? A ARG 2 59 3 Y 1 A GLY 3 ? A GLY 3 60 3 Y 1 A SER 4 ? A SER 4 61 3 Y 1 A HIS 5 ? A HIS 5 62 3 Y 1 A HIS 6 ? A HIS 6 63 3 Y 1 A HIS 7 ? A HIS 7 64 3 Y 1 A HIS 8 ? A HIS 8 65 3 Y 1 A HIS 9 ? A HIS 9 66 3 Y 1 A HIS 10 ? A HIS 10 67 3 Y 1 A GLY 11 ? A GLY 11 68 3 Y 1 A SER 12 ? A SER 12 69 3 Y 1 A GLU 13 ? A GLU 13 70 3 Y 1 A LYS 14 ? A LYS 14 71 3 Y 1 A LEU 15 ? A LEU 15 72 3 Y 1 A ALA 16 ? A ALA 16 73 3 Y 1 A LYS 17 ? A LYS 17 74 3 Y 1 A THR 18 ? A THR 18 75 3 Y 1 A LYS 19 ? A LYS 19 76 3 Y 1 A SER 20 ? A SER 20 77 3 Y 1 A THR 21 ? A THR 21 78 3 Y 1 A MET 22 ? A MET 22 79 3 Y 1 A VAL 23 ? A VAL 23 80 3 Y 1 A ASP 24 ? A ASP 24 81 3 Y 1 A VAL 25 ? A VAL 25 82 3 Y 1 A SER 26 ? A SER 26 83 3 Y 1 A ASP 27 ? A ASP 27 84 3 Y 1 A LYS 28 ? A LYS 28 85 4 Y 1 A MET 1 ? A MET 1 86 4 Y 1 A ARG 2 ? A ARG 2 87 4 Y 1 A GLY 3 ? A GLY 3 88 4 Y 1 A SER 4 ? A SER 4 89 4 Y 1 A HIS 5 ? A HIS 5 90 4 Y 1 A HIS 6 ? A HIS 6 91 4 Y 1 A HIS 7 ? A HIS 7 92 4 Y 1 A HIS 8 ? A HIS 8 93 4 Y 1 A HIS 9 ? A HIS 9 94 4 Y 1 A HIS 10 ? A HIS 10 95 4 Y 1 A GLY 11 ? A GLY 11 96 4 Y 1 A SER 12 ? A SER 12 97 4 Y 1 A GLU 13 ? A GLU 13 98 4 Y 1 A LYS 14 ? A LYS 14 99 4 Y 1 A LEU 15 ? A LEU 15 100 4 Y 1 A ALA 16 ? A ALA 16 101 4 Y 1 A LYS 17 ? A LYS 17 102 4 Y 1 A THR 18 ? A THR 18 103 4 Y 1 A LYS 19 ? A LYS 19 104 4 Y 1 A SER 20 ? A SER 20 105 4 Y 1 A THR 21 ? A THR 21 106 4 Y 1 A MET 22 ? A MET 22 107 4 Y 1 A VAL 23 ? A VAL 23 108 4 Y 1 A ASP 24 ? A ASP 24 109 4 Y 1 A VAL 25 ? A VAL 25 110 4 Y 1 A SER 26 ? A SER 26 111 4 Y 1 A ASP 27 ? A ASP 27 112 4 Y 1 A LYS 28 ? A LYS 28 113 5 Y 1 A MET 1 ? A MET 1 114 5 Y 1 A ARG 2 ? A ARG 2 115 5 Y 1 A GLY 3 ? A GLY 3 116 5 Y 1 A SER 4 ? A SER 4 117 5 Y 1 A HIS 5 ? A HIS 5 118 5 Y 1 A HIS 6 ? A HIS 6 119 5 Y 1 A HIS 7 ? A HIS 7 120 5 Y 1 A HIS 8 ? A HIS 8 121 5 Y 1 A HIS 9 ? A HIS 9 122 5 Y 1 A HIS 10 ? A HIS 10 123 5 Y 1 A GLY 11 ? A GLY 11 124 5 Y 1 A SER 12 ? A SER 12 125 5 Y 1 A GLU 13 ? A GLU 13 126 5 Y 1 A LYS 14 ? A LYS 14 127 5 Y 1 A LEU 15 ? A LEU 15 128 5 Y 1 A ALA 16 ? A ALA 16 129 5 Y 1 A LYS 17 ? A LYS 17 130 5 Y 1 A THR 18 ? A THR 18 131 5 Y 1 A LYS 19 ? A LYS 19 132 5 Y 1 A SER 20 ? A SER 20 133 5 Y 1 A THR 21 ? A THR 21 134 5 Y 1 A MET 22 ? A MET 22 135 5 Y 1 A VAL 23 ? A VAL 23 136 5 Y 1 A ASP 24 ? A ASP 24 137 5 Y 1 A VAL 25 ? A VAL 25 138 5 Y 1 A SER 26 ? A SER 26 139 5 Y 1 A ASP 27 ? A ASP 27 140 5 Y 1 A LYS 28 ? A LYS 28 141 6 Y 1 A MET 1 ? A MET 1 142 6 Y 1 A ARG 2 ? A ARG 2 143 6 Y 1 A GLY 3 ? A GLY 3 144 6 Y 1 A SER 4 ? A SER 4 145 6 Y 1 A HIS 5 ? A HIS 5 146 6 Y 1 A HIS 6 ? A HIS 6 147 6 Y 1 A HIS 7 ? A HIS 7 148 6 Y 1 A HIS 8 ? A HIS 8 149 6 Y 1 A HIS 9 ? A HIS 9 150 6 Y 1 A HIS 10 ? A HIS 10 151 6 Y 1 A GLY 11 ? A GLY 11 152 6 Y 1 A SER 12 ? A SER 12 153 6 Y 1 A GLU 13 ? A GLU 13 154 6 Y 1 A LYS 14 ? A LYS 14 155 6 Y 1 A LEU 15 ? A LEU 15 156 6 Y 1 A ALA 16 ? A ALA 16 157 6 Y 1 A LYS 17 ? A LYS 17 158 6 Y 1 A THR 18 ? A THR 18 159 6 Y 1 A LYS 19 ? A LYS 19 160 6 Y 1 A SER 20 ? A SER 20 161 6 Y 1 A THR 21 ? A THR 21 162 6 Y 1 A MET 22 ? A MET 22 163 6 Y 1 A VAL 23 ? A VAL 23 164 6 Y 1 A ASP 24 ? A ASP 24 165 6 Y 1 A VAL 25 ? A VAL 25 166 6 Y 1 A SER 26 ? A SER 26 167 6 Y 1 A ASP 27 ? A ASP 27 168 6 Y 1 A LYS 28 ? A LYS 28 169 7 Y 1 A MET 1 ? A MET 1 170 7 Y 1 A ARG 2 ? A ARG 2 171 7 Y 1 A GLY 3 ? A GLY 3 172 7 Y 1 A SER 4 ? A SER 4 173 7 Y 1 A HIS 5 ? A HIS 5 174 7 Y 1 A HIS 6 ? A HIS 6 175 7 Y 1 A HIS 7 ? A HIS 7 176 7 Y 1 A HIS 8 ? A HIS 8 177 7 Y 1 A HIS 9 ? A HIS 9 178 7 Y 1 A HIS 10 ? A HIS 10 179 7 Y 1 A GLY 11 ? A GLY 11 180 7 Y 1 A SER 12 ? A SER 12 181 7 Y 1 A GLU 13 ? A GLU 13 182 7 Y 1 A LYS 14 ? A LYS 14 183 7 Y 1 A LEU 15 ? A LEU 15 184 7 Y 1 A ALA 16 ? A ALA 16 185 7 Y 1 A LYS 17 ? A LYS 17 186 7 Y 1 A THR 18 ? A THR 18 187 7 Y 1 A LYS 19 ? A LYS 19 188 7 Y 1 A SER 20 ? A SER 20 189 7 Y 1 A THR 21 ? A THR 21 190 7 Y 1 A MET 22 ? A MET 22 191 7 Y 1 A VAL 23 ? A VAL 23 192 7 Y 1 A ASP 24 ? A ASP 24 193 7 Y 1 A VAL 25 ? A VAL 25 194 7 Y 1 A SER 26 ? A SER 26 195 7 Y 1 A ASP 27 ? A ASP 27 196 7 Y 1 A LYS 28 ? A LYS 28 197 8 Y 1 A MET 1 ? A MET 1 198 8 Y 1 A ARG 2 ? A ARG 2 199 8 Y 1 A GLY 3 ? A GLY 3 200 8 Y 1 A SER 4 ? A SER 4 201 8 Y 1 A HIS 5 ? A HIS 5 202 8 Y 1 A HIS 6 ? A HIS 6 203 8 Y 1 A HIS 7 ? A HIS 7 204 8 Y 1 A HIS 8 ? A HIS 8 205 8 Y 1 A HIS 9 ? A HIS 9 206 8 Y 1 A HIS 10 ? A HIS 10 207 8 Y 1 A GLY 11 ? A GLY 11 208 8 Y 1 A SER 12 ? A SER 12 209 8 Y 1 A GLU 13 ? A GLU 13 210 8 Y 1 A LYS 14 ? A LYS 14 211 8 Y 1 A LEU 15 ? A LEU 15 212 8 Y 1 A ALA 16 ? A ALA 16 213 8 Y 1 A LYS 17 ? A LYS 17 214 8 Y 1 A THR 18 ? A THR 18 215 8 Y 1 A LYS 19 ? A LYS 19 216 8 Y 1 A SER 20 ? A SER 20 217 8 Y 1 A THR 21 ? A THR 21 218 8 Y 1 A MET 22 ? A MET 22 219 8 Y 1 A VAL 23 ? A VAL 23 220 8 Y 1 A ASP 24 ? A ASP 24 221 8 Y 1 A VAL 25 ? A VAL 25 222 8 Y 1 A SER 26 ? A SER 26 223 8 Y 1 A ASP 27 ? A ASP 27 224 8 Y 1 A LYS 28 ? A LYS 28 225 9 Y 1 A MET 1 ? A MET 1 226 9 Y 1 A ARG 2 ? A ARG 2 227 9 Y 1 A GLY 3 ? A GLY 3 228 9 Y 1 A SER 4 ? A SER 4 229 9 Y 1 A HIS 5 ? A HIS 5 230 9 Y 1 A HIS 6 ? A HIS 6 231 9 Y 1 A HIS 7 ? A HIS 7 232 9 Y 1 A HIS 8 ? A HIS 8 233 9 Y 1 A HIS 9 ? A HIS 9 234 9 Y 1 A HIS 10 ? A HIS 10 235 9 Y 1 A GLY 11 ? A GLY 11 236 9 Y 1 A SER 12 ? A SER 12 237 9 Y 1 A GLU 13 ? A GLU 13 238 9 Y 1 A LYS 14 ? A LYS 14 239 9 Y 1 A LEU 15 ? A LEU 15 240 9 Y 1 A ALA 16 ? A ALA 16 241 9 Y 1 A LYS 17 ? A LYS 17 242 9 Y 1 A THR 18 ? A THR 18 243 9 Y 1 A LYS 19 ? A LYS 19 244 9 Y 1 A SER 20 ? A SER 20 245 9 Y 1 A THR 21 ? A THR 21 246 9 Y 1 A MET 22 ? A MET 22 247 9 Y 1 A VAL 23 ? A VAL 23 248 9 Y 1 A ASP 24 ? A ASP 24 249 9 Y 1 A VAL 25 ? A VAL 25 250 9 Y 1 A SER 26 ? A SER 26 251 9 Y 1 A ASP 27 ? A ASP 27 252 9 Y 1 A LYS 28 ? A LYS 28 253 10 Y 1 A MET 1 ? A MET 1 254 10 Y 1 A ARG 2 ? A ARG 2 255 10 Y 1 A GLY 3 ? A GLY 3 256 10 Y 1 A SER 4 ? A SER 4 257 10 Y 1 A HIS 5 ? A HIS 5 258 10 Y 1 A HIS 6 ? A HIS 6 259 10 Y 1 A HIS 7 ? A HIS 7 260 10 Y 1 A HIS 8 ? A HIS 8 261 10 Y 1 A HIS 9 ? A HIS 9 262 10 Y 1 A HIS 10 ? A HIS 10 263 10 Y 1 A GLY 11 ? A GLY 11 264 10 Y 1 A SER 12 ? A SER 12 265 10 Y 1 A GLU 13 ? A GLU 13 266 10 Y 1 A LYS 14 ? A LYS 14 267 10 Y 1 A LEU 15 ? A LEU 15 268 10 Y 1 A ALA 16 ? A ALA 16 269 10 Y 1 A LYS 17 ? A LYS 17 270 10 Y 1 A THR 18 ? A THR 18 271 10 Y 1 A LYS 19 ? A LYS 19 272 10 Y 1 A SER 20 ? A SER 20 273 10 Y 1 A THR 21 ? A THR 21 274 10 Y 1 A MET 22 ? A MET 22 275 10 Y 1 A VAL 23 ? A VAL 23 276 10 Y 1 A ASP 24 ? A ASP 24 277 10 Y 1 A VAL 25 ? A VAL 25 278 10 Y 1 A SER 26 ? A SER 26 279 10 Y 1 A ASP 27 ? A ASP 27 280 10 Y 1 A LYS 28 ? A LYS 28 281 11 Y 1 A MET 1 ? A MET 1 282 11 Y 1 A ARG 2 ? A ARG 2 283 11 Y 1 A GLY 3 ? A GLY 3 284 11 Y 1 A SER 4 ? A SER 4 285 11 Y 1 A HIS 5 ? A HIS 5 286 11 Y 1 A HIS 6 ? A HIS 6 287 11 Y 1 A HIS 7 ? A HIS 7 288 11 Y 1 A HIS 8 ? A HIS 8 289 11 Y 1 A HIS 9 ? A HIS 9 290 11 Y 1 A HIS 10 ? A HIS 10 291 11 Y 1 A GLY 11 ? A GLY 11 292 11 Y 1 A SER 12 ? A SER 12 293 11 Y 1 A GLU 13 ? A GLU 13 294 11 Y 1 A LYS 14 ? A LYS 14 295 11 Y 1 A LEU 15 ? A LEU 15 296 11 Y 1 A ALA 16 ? A ALA 16 297 11 Y 1 A LYS 17 ? A LYS 17 298 11 Y 1 A THR 18 ? A THR 18 299 11 Y 1 A LYS 19 ? A LYS 19 300 11 Y 1 A SER 20 ? A SER 20 301 11 Y 1 A THR 21 ? A THR 21 302 11 Y 1 A MET 22 ? A MET 22 303 11 Y 1 A VAL 23 ? A VAL 23 304 11 Y 1 A ASP 24 ? A ASP 24 305 11 Y 1 A VAL 25 ? A VAL 25 306 11 Y 1 A SER 26 ? A SER 26 307 11 Y 1 A ASP 27 ? A ASP 27 308 11 Y 1 A LYS 28 ? A LYS 28 309 12 Y 1 A MET 1 ? A MET 1 310 12 Y 1 A ARG 2 ? A ARG 2 311 12 Y 1 A GLY 3 ? A GLY 3 312 12 Y 1 A SER 4 ? A SER 4 313 12 Y 1 A HIS 5 ? A HIS 5 314 12 Y 1 A HIS 6 ? A HIS 6 315 12 Y 1 A HIS 7 ? A HIS 7 316 12 Y 1 A HIS 8 ? A HIS 8 317 12 Y 1 A HIS 9 ? A HIS 9 318 12 Y 1 A HIS 10 ? A HIS 10 319 12 Y 1 A GLY 11 ? A GLY 11 320 12 Y 1 A SER 12 ? A SER 12 321 12 Y 1 A GLU 13 ? A GLU 13 322 12 Y 1 A LYS 14 ? A LYS 14 323 12 Y 1 A LEU 15 ? A LEU 15 324 12 Y 1 A ALA 16 ? A ALA 16 325 12 Y 1 A LYS 17 ? A LYS 17 326 12 Y 1 A THR 18 ? A THR 18 327 12 Y 1 A LYS 19 ? A LYS 19 328 12 Y 1 A SER 20 ? A SER 20 329 12 Y 1 A THR 21 ? A THR 21 330 12 Y 1 A MET 22 ? A MET 22 331 12 Y 1 A VAL 23 ? A VAL 23 332 12 Y 1 A ASP 24 ? A ASP 24 333 12 Y 1 A VAL 25 ? A VAL 25 334 12 Y 1 A SER 26 ? A SER 26 335 12 Y 1 A ASP 27 ? A ASP 27 336 12 Y 1 A LYS 28 ? A LYS 28 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 800 2 ? Bruker DRX 600 # _atom_sites.entry_id 1HXV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_