data_1HY8 # _entry.id 1HY8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1HY8 pdb_00001hy8 10.2210/pdb1hy8/pdb RCSB RCSB012681 ? ? WWPDB D_1000012681 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HY8 _pdbx_database_status.recvd_initial_deposition_date 2001-01-18 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xu, G.-Y.' 1 'Tam, A.' 2 'Lin, L.' 3 'Hixon, J.' 4 'Fritz, C.C.' 5 'Power, R.' 6 # _citation.id primary _citation.title 'Solution structure of B. subtilis acyl carrier protein.' _citation.journal_abbrev Structure _citation.journal_volume 9 _citation.page_first 277 _citation.page_last 287 _citation.year 2001 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11525165 _citation.pdbx_database_id_DOI '10.1016/S0969-2126(01)00586-X' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, G.Y.' 1 ? primary 'Tam, A.' 2 ? primary 'Lin, L.' 3 ? primary 'Hixon, J.' 4 ? primary 'Fritz, C.C.' 5 ? primary 'Powers, R.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ACYL CARRIER PROTEIN' _entity.formula_weight 8466.245 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ACP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQQ _entity_poly.pdbx_seq_one_letter_code_can ADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 THR n 1 4 LEU n 1 5 GLU n 1 6 ARG n 1 7 VAL n 1 8 THR n 1 9 LYS n 1 10 ILE n 1 11 ILE n 1 12 VAL n 1 13 ASP n 1 14 ARG n 1 15 LEU n 1 16 GLY n 1 17 VAL n 1 18 ASP n 1 19 GLU n 1 20 ALA n 1 21 ASP n 1 22 VAL n 1 23 LYS n 1 24 LEU n 1 25 GLU n 1 26 ALA n 1 27 SER n 1 28 PHE n 1 29 LYS n 1 30 GLU n 1 31 ASP n 1 32 LEU n 1 33 GLY n 1 34 ALA n 1 35 ASP n 1 36 SER n 1 37 LEU n 1 38 ASP n 1 39 VAL n 1 40 VAL n 1 41 GLU n 1 42 LEU n 1 43 VAL n 1 44 MET n 1 45 GLU n 1 46 LEU n 1 47 GLU n 1 48 ASP n 1 49 GLU n 1 50 PHE n 1 51 ASP n 1 52 MET n 1 53 GLU n 1 54 ILE n 1 55 SER n 1 56 ASP n 1 57 GLU n 1 58 ASP n 1 59 ALA n 1 60 GLU n 1 61 LYS n 1 62 ILE n 1 63 ALA n 1 64 THR n 1 65 VAL n 1 66 GLY n 1 67 ASP n 1 68 ALA n 1 69 VAL n 1 70 ASN n 1 71 TYR n 1 72 ILE n 1 73 GLN n 1 74 ASN n 1 75 GLN n 1 76 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PGEX-6P-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ACP_BACSU _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P80643 _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_seq_one_letter_code ADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQQ _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1HY8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 76 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P80643 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 77 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 76 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 3.4 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM sample is the mixture of U-15N/13C labeled holo- (60%)and apo-ACP (40%)' _pdbx_nmr_sample_details.solvent_system ;50 mM Bis-Tris, 100 mM sodium chloride, 10 mM magnesium chloride and 10 mM DTT in 5% D2O, 95% H2O ; # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model UNITYPLUS _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1HY8 _pdbx_nmr_refine.method 'Distance geometry, Simulated annealing, molecular dynamics' _pdbx_nmr_refine.details ;The structures are based on a total of 1050 distance constraints from NOE and H-bond, 96 dihedral angle constraints from Talos program and 76 pairs of CA/CB chemical shift constraints ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1HY8 _pdbx_nmr_details.text ;This structure was determinined using 3D triple-resonance experiments with the enhanced-sensitivity pulse field gradient approach, simultaneous 15N/13C-edited NOESY and 2D constant time 13C-1H HSQC techniques. ; # _pdbx_nmr_ensemble.entry_id 1HY8 _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 98.0 'structure solution' 'Badger, J., Kumar, R.A., Yip, P.' 1 NMRPipe '1.8, 2000' processing 'Delaglio, F.' 2 PIPP '4.2.2, 1998' 'data analysis' 'Garrett, D.' 3 X-PLOR 98.0 refinement 'Badger, J., Kumar, R.A., Yip, P.' 4 # _exptl.entry_id 1HY8 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1HY8 _struct.title 'SOLUTION STRUCTURE OF B. SUBTILIS ACYL CARRIER PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1HY8 _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' _struct_keywords.text ;apo-ACP, holo-ACP, ACPS, Fatty Acid Biosynthesis, 4' phosphopantetheine prosthetic group, LIPID BINDING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 1 ? ARG A 14 ? ALA A 1 ARG A 14 1 ? 14 HELX_P HELX_P2 2 ASP A 35 ? PHE A 50 ? ASP A 35 PHE A 50 1 ? 16 HELX_P HELX_P3 3 SER A 55 ? ILE A 62 ? SER A 55 ILE A 62 1 ? 8 HELX_P HELX_P4 4 THR A 64 ? GLN A 76 ? THR A 64 GLN A 76 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1HY8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1HY8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 GLN 76 76 76 GLN GLN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-01-23 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ASP 58 ? ? H A ILE 62 ? ? 1.54 2 1 O A LEU 4 ? ? H A THR 8 ? ? 1.59 3 1 O A VAL 7 ? ? H A ILE 11 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 14 ? ? -101.11 -87.92 2 1 VAL A 17 ? ? 59.77 -85.96 3 1 GLU A 19 ? ? 64.28 75.84 4 1 ALA A 20 ? ? 170.07 -42.39 5 1 LYS A 29 ? ? -172.44 -45.11 6 1 VAL A 39 ? ? -59.62 -75.51 7 1 ASP A 51 ? ? 57.85 83.28 8 1 ASP A 58 ? ? -71.32 -77.63 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 6 ? ? 0.265 'SIDE CHAIN' 2 1 ARG A 14 ? ? 0.267 'SIDE CHAIN' #