data_1HYM # _entry.id 1HYM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1HYM WWPDB D_1000174074 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HYM _pdbx_database_status.recvd_initial_deposition_date 1995-06-12 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cai, M.' 1 'Gong, Y.' 2 'Prakash, O.' 3 'Krishnamoorthi, R.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Reactive-site hydrolyzed Cucurbita maxima trypsin inhibitor-V: function, thermodynamic stability, and NMR solution structure.' Biochemistry 34 12087 12094 1995 BICHAW US 0006-2960 0033 ? 7547948 10.1021/bi00038a001 1 'Three-Dimensional Solution Structure of Cucurbita Maxima Trypsin Inhibitor-V Determined by NMR Spectroscopy' Biochemistry 34 5201 ? 1995 BICHAW US 0006-2960 0033 ? ? ? 2 'A New Protein Inhibitor of Trypsin and Activated Hageman Factor from Pumpkin (Cucurbita Maxima) Seeds' 'FEBS Lett.' 273 163 ? 1990 FEBLAL NE 0014-5793 0165 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Cai, M.' 1 primary 'Gong, Y.' 2 primary 'Prakash, O.' 3 primary 'Krishnamoorthi, R.' 4 1 'Cai, M.' 5 1 'Gong, Y.' 6 1 'Kao, J.L.F.' 7 1 'Krishnamoorthi, R.' 8 2 'Krishnamoorthi, R.' 9 2 'Gong, Y.' 10 2 'Richardson, M.' 11 # _cell.entry_id 1HYM _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1HYM _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'HYDROLYZED CUCURBITA MAXIMA TRYPSIN INHIBITOR V' 4574.263 1 ? ? ? ? 2 polymer nat 'HYDROLYZED CUCURBITA MAXIMA TRYPSIN INHIBITOR V' 2844.391 1 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 CMTI-V 2 CMTI-V # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes '(ACE)SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK' XSSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK A ? 2 'polypeptide(L)' no no DFRCNRVRIWVNKRGLVVSPPRIG DFRCNRVRIWVNKRGLVVSPPRIG B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 SER n 1 3 SER n 1 4 CYS n 1 5 PRO n 1 6 GLY n 1 7 LYS n 1 8 SER n 1 9 SER n 1 10 TRP n 1 11 PRO n 1 12 HIS n 1 13 LEU n 1 14 VAL n 1 15 GLY n 1 16 VAL n 1 17 GLY n 1 18 GLY n 1 19 SER n 1 20 VAL n 1 21 ALA n 1 22 LYS n 1 23 ALA n 1 24 ILE n 1 25 ILE n 1 26 GLU n 1 27 ARG n 1 28 GLN n 1 29 ASN n 1 30 PRO n 1 31 ASN n 1 32 VAL n 1 33 LYS n 1 34 ALA n 1 35 VAL n 1 36 ILE n 1 37 LEU n 1 38 GLU n 1 39 GLU n 1 40 GLY n 1 41 THR n 1 42 PRO n 1 43 VAL n 1 44 THR n 1 45 LYS n 2 1 ASP n 2 2 PHE n 2 3 ARG n 2 4 CYS n 2 5 ASN n 2 6 ARG n 2 7 VAL n 2 8 ARG n 2 9 ILE n 2 10 TRP n 2 11 VAL n 2 12 ASN n 2 13 LYS n 2 14 ARG n 2 15 GLY n 2 16 LEU n 2 17 VAL n 2 18 VAL n 2 19 SER n 2 20 PRO n 2 21 PRO n 2 22 ARG n 2 23 ILE n 2 24 GLY n # loop_ _entity_src_nat.entity_id _entity_src_nat.pdbx_src_id _entity_src_nat.pdbx_alt_source_flag _entity_src_nat.pdbx_beg_seq_num _entity_src_nat.pdbx_end_seq_num _entity_src_nat.common_name _entity_src_nat.pdbx_organism_scientific _entity_src_nat.pdbx_ncbi_taxonomy_id _entity_src_nat.genus _entity_src_nat.species _entity_src_nat.strain _entity_src_nat.tissue _entity_src_nat.tissue_fraction _entity_src_nat.pdbx_secretion _entity_src_nat.pdbx_fragment _entity_src_nat.pdbx_variant _entity_src_nat.pdbx_cell_line _entity_src_nat.pdbx_atcc _entity_src_nat.pdbx_cellular_location _entity_src_nat.pdbx_organ _entity_src_nat.pdbx_organelle _entity_src_nat.pdbx_cell _entity_src_nat.pdbx_plasmid_name _entity_src_nat.pdbx_plasmid_details _entity_src_nat.details 1 1 sample ? ? 'winter squash' 'Cucurbita maxima' 3661 Cucurbita ? ? SEED ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample ? ? 'winter squash' 'Cucurbita maxima' 3661 Cucurbita ? ? SEED ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform _struct_ref.pdbx_seq_one_letter_code 1 UNP ITH5_CUCMA P19873 1 1 ? ? 2 UNP ITH5_CUCMA P19873 2 45 ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1HYM A 2 ? 45 ? P19873 1 ? 44 ? 1 44 2 2 1HYM B 1 ? 24 ? P19873 45 ? 68 ? 45 68 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1HYM _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _exptl.entry_id 1HYM _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1HYM _struct.title 'HYDROLYZED TRYPSIN INHIBITOR (CMTI-V, MINIMIZED AVERAGE NMR STRUCTURE)' _struct.pdbx_descriptor 'HYDROLYZED CUCURBITA MAXIMA TRYPSIN INHIBITOR V' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1HYM _struct_keywords.pdbx_keywords 'HYDROLASE (SERINE PROTEINASE)' _struct_keywords.text 'HYDROLASE (SERINE PROTEINASE)' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id A _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 19 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 29 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 18 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 28 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 B CYS 4 SG ? ? A CYS 3 B CYS 48 1_555 ? ? ? ? ? ? ? 2.020 ? covale1 covale ? ? A ACE 1 C ? ? ? 1_555 A SER 2 N ? ? A ACE 0 A SER 1 1_555 ? ? ? ? ? ? ? 1.305 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details S1 ? 2 ? S2 ? 2 ? S3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S2 1 2 ? anti-parallel S3 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 SER A 8 ? TRP A 10 ? SER A 7 TRP A 9 S1 2 ARG B 22 ? ILE B 23 ? ARG B 66 ILE B 67 S2 1 TRP B 10 ? ASN B 12 ? TRP B 54 ASN B 56 S2 2 LEU B 16 ? VAL B 18 ? LEU B 60 VAL B 62 S3 1 ARG B 6 ? ASN B 12 ? ARG B 50 ASN B 56 S3 2 LYS A 33 ? GLU A 39 ? LYS A 32 GLU A 38 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 O SER A 8 ? O SER A 7 N ILE B 23 ? N ILE B 67 S2 1 2 N TRP B 10 ? N TRP B 54 O VAL B 18 ? O VAL B 62 S3 1 2 O ASN B 12 ? O ASN B 56 N GLU A 39 ? N GLU A 38 # _database_PDB_matrix.entry_id 1HYM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1HYM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 0 0 ACE ACE A . n A 1 2 SER 2 1 1 SER SER A . n A 1 3 SER 3 2 2 SER SER A . n A 1 4 CYS 4 3 3 CYS CYS A . n A 1 5 PRO 5 4 4 PRO PRO A . n A 1 6 GLY 6 5 5 GLY GLY A . n A 1 7 LYS 7 6 6 LYS LYS A . n A 1 8 SER 8 7 7 SER SER A . n A 1 9 SER 9 8 8 SER SER A . n A 1 10 TRP 10 9 9 TRP TRP A . n A 1 11 PRO 11 10 10 PRO PRO A . n A 1 12 HIS 12 11 11 HIS HIS A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 VAL 14 13 13 VAL VAL A . n A 1 15 GLY 15 14 14 GLY GLY A . n A 1 16 VAL 16 15 15 VAL VAL A . n A 1 17 GLY 17 16 16 GLY GLY A . n A 1 18 GLY 18 17 17 GLY GLY A . n A 1 19 SER 19 18 18 SER SER A . n A 1 20 VAL 20 19 19 VAL VAL A . n A 1 21 ALA 21 20 20 ALA ALA A . n A 1 22 LYS 22 21 21 LYS LYS A . n A 1 23 ALA 23 22 22 ALA ALA A . n A 1 24 ILE 24 23 23 ILE ILE A . n A 1 25 ILE 25 24 24 ILE ILE A . n A 1 26 GLU 26 25 25 GLU GLU A . n A 1 27 ARG 27 26 26 ARG ARG A . n A 1 28 GLN 28 27 27 GLN GLN A . n A 1 29 ASN 29 28 28 ASN ASN A . n A 1 30 PRO 30 29 29 PRO PRO A . n A 1 31 ASN 31 30 30 ASN ASN A . n A 1 32 VAL 32 31 31 VAL VAL A . n A 1 33 LYS 33 32 32 LYS LYS A . n A 1 34 ALA 34 33 33 ALA ALA A . n A 1 35 VAL 35 34 34 VAL VAL A . n A 1 36 ILE 36 35 35 ILE ILE A . n A 1 37 LEU 37 36 36 LEU LEU A . n A 1 38 GLU 38 37 37 GLU GLU A . n A 1 39 GLU 39 38 38 GLU GLU A . n A 1 40 GLY 40 39 39 GLY GLY A . n A 1 41 THR 41 40 40 THR THR A . n A 1 42 PRO 42 41 41 PRO PRO A . n A 1 43 VAL 43 42 42 VAL VAL A . n A 1 44 THR 44 43 43 THR THR A . n A 1 45 LYS 45 44 44 LYS LYS A . n B 2 1 ASP 1 45 45 ASP ASP B . n B 2 2 PHE 2 46 46 PHE PHE B . n B 2 3 ARG 3 47 47 ARG ARG B . n B 2 4 CYS 4 48 48 CYS CYS B . n B 2 5 ASN 5 49 49 ASN ASN B . n B 2 6 ARG 6 50 50 ARG ARG B . n B 2 7 VAL 7 51 51 VAL VAL B . n B 2 8 ARG 8 52 52 ARG ARG B . n B 2 9 ILE 9 53 53 ILE ILE B . n B 2 10 TRP 10 54 54 TRP TRP B . n B 2 11 VAL 11 55 55 VAL VAL B . n B 2 12 ASN 12 56 56 ASN ASN B . n B 2 13 LYS 13 57 57 LYS LYS B . n B 2 14 ARG 14 58 58 ARG ARG B . n B 2 15 GLY 15 59 59 GLY GLY B . n B 2 16 LEU 16 60 60 LEU LEU B . n B 2 17 VAL 17 61 61 VAL VAL B . n B 2 18 VAL 18 62 62 VAL VAL B . n B 2 19 SER 19 63 63 SER SER B . n B 2 20 PRO 20 64 64 PRO PRO B . n B 2 21 PRO 21 65 65 PRO PRO B . n B 2 22 ARG 22 66 66 ARG ARG B . n B 2 23 ILE 23 67 67 ILE ILE B . n B 2 24 GLY 24 68 68 GLY GLY B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-09-15 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD13 A LEU 36 ? ? HA B TRP 54 ? ? 1.26 2 1 HB3 A ASN 28 ? ? HG23 A VAL 31 ? ? 1.27 3 1 HA A GLU 37 ? ? HG21 B VAL 55 ? ? 1.30 4 1 HB2 A LYS 6 ? ? HG2 A GLN 27 ? ? 1.31 5 1 HG11 A VAL 13 ? ? HA B VAL 62 ? ? 1.33 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A HIS 11 ? ? ND1 A HIS 11 ? ? 1.267 1.369 -0.102 0.015 N 2 1 CG B TRP 54 ? ? CD2 B TRP 54 ? ? 1.328 1.432 -0.104 0.017 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG A TRP 9 ? ? CD1 A TRP 9 ? ? NE1 A TRP 9 ? ? 103.60 110.10 -6.50 1.00 N 2 1 CD1 A TRP 9 ? ? NE1 A TRP 9 ? ? CE2 A TRP 9 ? ? 115.10 109.00 6.10 0.90 N 3 1 NE1 A TRP 9 ? ? CE2 A TRP 9 ? ? CZ2 A TRP 9 ? ? 139.13 130.40 8.73 1.10 N 4 1 NE1 A TRP 9 ? ? CE2 A TRP 9 ? ? CD2 A TRP 9 ? ? 100.92 107.30 -6.38 1.00 N 5 1 CG B TRP 54 ? ? CD1 B TRP 54 ? ? NE1 B TRP 54 ? ? 103.57 110.10 -6.53 1.00 N 6 1 CD1 B TRP 54 ? ? NE1 B TRP 54 ? ? CE2 B TRP 54 ? ? 115.06 109.00 6.06 0.90 N 7 1 NE1 B TRP 54 ? ? CE2 B TRP 54 ? ? CZ2 B TRP 54 ? ? 139.28 130.40 8.88 1.10 N 8 1 NE1 B TRP 54 ? ? CE2 B TRP 54 ? ? CD2 B TRP 54 ? ? 100.81 107.30 -6.49 1.00 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 4 ? ? -56.97 -170.68 2 1 LYS A 6 ? ? -53.84 100.03 3 1 PRO A 10 ? ? -66.62 -113.98 4 1 HIS A 11 ? ? -155.00 67.76 5 1 LEU A 12 ? ? -79.95 29.68 6 1 VAL A 15 ? ? -84.32 43.11 7 1 PRO A 29 ? ? -59.26 1.17 8 1 PRO A 41 ? ? -58.21 106.75 9 1 THR A 43 ? ? -45.15 105.43 10 1 ARG B 58 ? ? -52.01 -9.96 11 1 ILE B 67 ? ? -81.76 -96.67 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 26 ? ? 0.175 'SIDE CHAIN' 2 1 ARG B 47 ? ? 0.239 'SIDE CHAIN' 3 1 ARG B 52 ? ? 0.256 'SIDE CHAIN' 4 1 ARG B 58 ? ? 0.128 'SIDE CHAIN' #