data_1HZM # _entry.id 1HZM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1HZM pdb_00001hzm 10.2210/pdb1hzm/pdb RCSB RCSB012721 ? ? WWPDB D_1000012721 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HZM _pdbx_database_status.recvd_initial_deposition_date 2001-01-25 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Farooq, A.' 1 'Zhou, M.-M.' 2 # _citation.id primary _citation.title 'Solution structure of ERK2 binding domain of MAPK phosphatase MKP-3: structural insights into MKP-3 activation by ERK2.' _citation.journal_abbrev Mol.Cell _citation.journal_volume 7 _citation.page_first 387 _citation.page_last 399 _citation.year 2001 _citation.journal_id_ASTM MOCEFL _citation.country US _citation.journal_id_ISSN 1097-2765 _citation.journal_id_CSD 2168 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11239467 _citation.pdbx_database_id_DOI '10.1016/S1097-2765(01)00186-1' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Farooq, A.' 1 ? primary 'Chaturvedi, G.' 2 ? primary 'Mujtaba, S.' 3 ? primary 'Plotnikova, O.' 4 ? primary 'Zeng, L.' 5 ? primary 'Dhalluin, C.' 6 ? primary 'Ashton, R.' 7 ? primary 'Zhou, M.M.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DUAL SPECIFICITY PROTEIN PHOSPHATASE 6' _entity.formula_weight 17424.748 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec '3.1.3.48, 3.1.3.16' _entity.pdbx_mutation ? _entity.pdbx_fragment 'RESIDUES 1-154' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MITOGEN-ACTIVATED PROTEIN KINASE PHOSPHATASE 3; MAP KINASE PHOSPHATASE 3; MKP-3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGNLPVRALFTRG EDRDRFTRRCGTDTVVLYDESSSDWNENTGGESLLGLLLKKLKDEGCRAFYLEGGFSKFQAEFSLHCETNLDGS ; _entity_poly.pdbx_seq_one_letter_code_can ;MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGNLPVRALFTRG EDRDRFTRRCGTDTVVLYDESSSDWNENTGGESLLGLLLKKLKDEGCRAFYLEGGFSKFQAEFSLHCETNLDGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 ASP n 1 4 THR n 1 5 LEU n 1 6 ARG n 1 7 PRO n 1 8 VAL n 1 9 PRO n 1 10 PHE n 1 11 ALA n 1 12 SER n 1 13 GLU n 1 14 MET n 1 15 ALA n 1 16 ILE n 1 17 SER n 1 18 LYS n 1 19 THR n 1 20 VAL n 1 21 ALA n 1 22 TRP n 1 23 LEU n 1 24 ASN n 1 25 GLU n 1 26 GLN n 1 27 LEU n 1 28 GLU n 1 29 LEU n 1 30 GLY n 1 31 ASN n 1 32 GLU n 1 33 ARG n 1 34 LEU n 1 35 LEU n 1 36 LEU n 1 37 MET n 1 38 ASP n 1 39 CYS n 1 40 ARG n 1 41 PRO n 1 42 GLN n 1 43 GLU n 1 44 LEU n 1 45 TYR n 1 46 GLU n 1 47 SER n 1 48 SER n 1 49 HIS n 1 50 ILE n 1 51 GLU n 1 52 SER n 1 53 ALA n 1 54 ILE n 1 55 ASN n 1 56 VAL n 1 57 ALA n 1 58 ILE n 1 59 PRO n 1 60 GLY n 1 61 ILE n 1 62 MET n 1 63 LEU n 1 64 ARG n 1 65 ARG n 1 66 LEU n 1 67 GLN n 1 68 LYS n 1 69 GLY n 1 70 ASN n 1 71 LEU n 1 72 PRO n 1 73 VAL n 1 74 ARG n 1 75 ALA n 1 76 LEU n 1 77 PHE n 1 78 THR n 1 79 ARG n 1 80 GLY n 1 81 GLU n 1 82 ASP n 1 83 ARG n 1 84 ASP n 1 85 ARG n 1 86 PHE n 1 87 THR n 1 88 ARG n 1 89 ARG n 1 90 CYS n 1 91 GLY n 1 92 THR n 1 93 ASP n 1 94 THR n 1 95 VAL n 1 96 VAL n 1 97 LEU n 1 98 TYR n 1 99 ASP n 1 100 GLU n 1 101 SER n 1 102 SER n 1 103 SER n 1 104 ASP n 1 105 TRP n 1 106 ASN n 1 107 GLU n 1 108 ASN n 1 109 THR n 1 110 GLY n 1 111 GLY n 1 112 GLU n 1 113 SER n 1 114 LEU n 1 115 LEU n 1 116 GLY n 1 117 LEU n 1 118 LEU n 1 119 LEU n 1 120 LYS n 1 121 LYS n 1 122 LEU n 1 123 LYS n 1 124 ASP n 1 125 GLU n 1 126 GLY n 1 127 CYS n 1 128 ARG n 1 129 ALA n 1 130 PHE n 1 131 TYR n 1 132 LEU n 1 133 GLU n 1 134 GLY n 1 135 GLY n 1 136 PHE n 1 137 SER n 1 138 LYS n 1 139 PHE n 1 140 GLN n 1 141 ALA n 1 142 GLU n 1 143 PHE n 1 144 SER n 1 145 LEU n 1 146 HIS n 1 147 CYS n 1 148 GLU n 1 149 THR n 1 150 ASN n 1 151 LEU n 1 152 ASP n 1 153 GLY n 1 154 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET15B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DUS6_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGNLPVRALFTRG EDRDRFTRRCGTDTVVLYDESSSDWNENTGGESLLGLLLKKLKDEGCRAFYLEGGFSKFQAEFSLHCETNLDGSCSSSSP PLPVLGLGGLRISSDSSSDIESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVT PNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAY DIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQQLYFTTPSNQNVYQVDSLQST ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession Q16828 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1HZM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 154 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q16828 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 154 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 154 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type '1H/15N-HSQC, HNCA, HN(CO)CA, HN(CA)CB, HN(COCA)CB, (H)C(CO)NH-TOCSY, 1H/15N-TOCSY, 1H/15N-NOESY, HCCH-TOCSY, 1H/13C-NOESY, HNHA-J' _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 200mM _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents 'UREA, NACL, IMIDAZOLE, DTT' _pdbx_nmr_sample_details.solvent_system ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DRX Bruker 600 ? 2 DRX Bruker 500 ? # _pdbx_nmr_ensemble.entry_id 1HZM _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' XPLOR-ARIA ? ? 1 refinement XPLOR-ARIA ? ? 2 # _exptl.entry_id 1HZM _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1HZM _struct.title 'STRUCTURE OF ERK2 BINDING DOMAIN OF MAPK PHOSPHATASE MKP-3: STRUCTURAL INSIGHTS INTO MKP-3 ACTIVATION BY ERK2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1HZM _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text Hydrolase # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TRP A 22 ? GLY A 30 ? TRP A 22 GLY A 30 1 ? 9 HELX_P HELX_P2 2 GLN A 42 ? HIS A 49 ? GLN A 42 HIS A 49 1 ? 8 HELX_P HELX_P3 3 GLY A 60 ? ARG A 65 ? GLY A 60 ARG A 65 1 ? 6 HELX_P HELX_P4 4 GLY A 80 ? ARG A 89 ? GLY A 80 ARG A 89 1 ? 10 HELX_P HELX_P5 5 SER A 113 ? GLU A 125 ? SER A 113 GLU A 125 1 ? 13 HELX_P HELX_P6 6 GLY A 135 ? SER A 144 ? GLY A 135 SER A 144 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 35 ? MET A 37 ? LEU A 35 MET A 37 A 2 VAL A 95 ? LEU A 97 ? VAL A 95 LEU A 97 A 3 PHE A 130 ? TYR A 131 ? PHE A 130 TYR A 131 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 35 ? O LEU A 35 N VAL A 96 ? N VAL A 96 A 2 3 O VAL A 95 ? O VAL A 95 N PHE A 130 ? N PHE A 130 # _database_PDB_matrix.entry_id 1HZM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1HZM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 TRP 105 105 105 TRP TRP A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 CYS 127 127 127 CYS CYS A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 PHE 139 139 139 PHE PHE A . n A 1 140 GLN 140 140 140 GLN GLN A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 HIS 146 146 146 HIS HIS A . n A 1 147 CYS 147 147 147 CYS CYS A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 ASN 150 150 150 ASN ASN A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 SER 154 154 154 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-01-25 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 5 ? ? 40.94 79.28 2 1 PRO A 7 ? ? -58.06 -168.54 3 1 PRO A 9 ? ? -56.12 -155.47 4 1 PHE A 10 ? ? -53.34 170.13 5 1 SER A 12 ? ? -166.44 30.39 6 1 ALA A 15 ? ? -101.12 -84.95 7 1 SER A 17 ? ? -170.93 79.35 8 1 LYS A 18 ? ? -108.30 -61.61 9 1 THR A 19 ? ? -170.80 -163.83 10 1 TRP A 22 ? ? 172.08 40.32 11 1 LEU A 23 ? ? 57.00 159.33 12 1 LEU A 29 ? ? -40.12 -80.91 13 1 ASN A 31 ? ? -147.55 -80.79 14 1 ASP A 38 ? ? -170.61 147.52 15 1 CYS A 39 ? ? 71.26 -160.80 16 1 ARG A 40 ? ? 179.16 -49.12 17 1 GLN A 42 ? ? -95.34 42.56 18 1 GLU A 43 ? ? -36.81 -32.61 19 1 ILE A 50 ? ? -136.03 -156.33 20 1 GLU A 51 ? ? -71.98 -84.23 21 1 ARG A 65 ? ? 167.96 111.13 22 1 LEU A 66 ? ? -64.98 73.82 23 1 LYS A 68 ? ? 175.50 -55.16 24 1 ASN A 70 ? ? -164.53 -30.36 25 1 LEU A 71 ? ? -37.19 138.15 26 1 ARG A 74 ? ? 49.74 26.98 27 1 PHE A 77 ? ? -178.83 -81.25 28 1 THR A 78 ? ? -63.44 77.09 29 1 ARG A 79 ? ? -148.21 -50.95 30 1 ASP A 93 ? ? -173.01 -57.65 31 1 GLU A 100 ? ? 76.51 170.65 32 1 SER A 102 ? ? 53.48 84.57 33 1 SER A 103 ? ? -159.96 -83.12 34 1 GLU A 107 ? ? 65.80 77.42 35 1 GLU A 112 ? ? -58.48 -160.82 36 1 SER A 113 ? ? -104.07 -60.02 37 1 LEU A 114 ? ? -55.16 -85.53 38 1 ALA A 129 ? ? 53.80 107.13 39 1 GLU A 133 ? ? -178.47 -80.98 40 1 PHE A 136 ? ? 55.80 163.11 41 1 SER A 144 ? ? -55.67 -167.15 42 1 LEU A 145 ? ? -55.24 88.94 43 1 HIS A 146 ? ? 174.16 -91.91 44 1 THR A 149 ? ? -143.09 -46.78 #